DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and LOC100489174

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031762470.1 Gene:LOC100489174 / 100489174 -ID:- Length:471 Species:Xenopus tropicalis


Alignment Length:276 Identity:85/276 - (30%)
Similarity:119/276 - (43%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ESSAISMISKAFMCRGDVNFVIVDAADYVDT--FYAWSALNTDLIGEHIGVGLTHLIELT----- 189
            |::.:|.:.||.:...|||.:.||..:....  .|..:|.|..|:|..|    .:|:::.     
 Frog   110 ENNWVSDMCKAILEAEDVNCIGVDWREGSGNIKMYVQAANNARLVGAEI----AYLLQVLQTEYG 170

  Fly   190 -PLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCF 253
             |...:|:|                   |||||||..|.||   |:..|  |.|||||||||..|
 Frog   171 YPASKVHVI-------------------GHSLGAHAAGEAG---KRHQG--IRRITGLDPAKQLF 211

  Fly   254 RREKILPGLTRGDAKLVDIIHTNI------GILAKRGPLGDVDFYPGGAHPIQPGCL-------- 304
            ........|...||..||:|||:|      ||:.   |:|.:||||.|...: |||.        
 Frog   212 EDTPEEVRLDPSDAGFVDVIHTDISFPLGVGIVK---PIGHLDFYPNGGKNM-PGCPPKLSDLGN 272

  Fly   305 ------TIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDEL---RKRDCSAGIVSPMG-YRMNP 359
                  |:.|:|.||..|:.||.  .:.:.|:|..|.|:...   ....|..|..:.|| |...|
 Frog   273 MDALVDTLTCNHFRAFLYYTESI--RRREGFLGYPCDSYKSFLSGASFPCPEGRCTFMGHYSQLP 335

  Fly   360 QA----RGIYYVDVNG 371
            .|    :.|:|::..|
 Frog   336 PALKAPQQIFYLNTGG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 84/273 (31%)
LOC100489174XP_031762470.1 Lipase 28..352 CDD:395099 85/276 (31%)
PLAT 359..471 CDD:412108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.