DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and dsn1

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_012824699.1 Gene:dsn1 / 100487901 XenbaseID:XB-GENE-6257745 Length:315 Species:Xenopus tropicalis


Alignment Length:108 Identity:21/108 - (19%)
Similarity:45/108 - (41%) Gaps:26/108 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EEGRLTRSWWDAVPRLLTDIATIKANILTAAP---------------LELASNIIDAVCSSTLFM 72
            ||.:||.:...::||    :.|.:..:|.:.|               :||   ::|.:..|...:
 Frog   218 EESKLTGTPCASIPR----VPTSQDCVLNSKPDYNQILAQQGAVFDCMEL---VLDELQESVHLL 275

  Fly    73 DRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSK 115
            :....:.:..:::|..|    .::.|...||.|.:.|..:.|:
 Frog   276 NSFLEETSQHLQRMSSQ----LKSRSFKALEDSPIRKLLKVSQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 8/31 (26%)
dsn1XP_012824699.1 MIS13 92..308 CDD:369747 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.