DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and hs3st5

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001120624.1 Gene:hs3st5 / 100145790 XenbaseID:XB-GENE-5795358 Length:345 Species:Xenopus tropicalis


Alignment Length:173 Identity:26/173 - (15%)
Similarity:59/173 - (34%) Gaps:49/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASK----LWKHSRFSKG----RKVVILATGWTN 128
            :.::|..|...:||...:.:....|....:::||:    ......::||    ||.:..:.....
 Frog    86 VQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYAKGIEWYRKKMPFSHPHQT 150

  Fly   129 TVNESSAI----SMISKAFMCRGDVNFVIV-------DAADYVD----------TFY-------- 164
            |:.:|.|.    .:..:.:.....:..:|:       ..:||..          |:|        
 Frog   151 TIEKSPAYFITDEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKMAMD 215

  Fly   165 --------AWSALNTDLIGEHIGVGLTHLIELTPLRNIHLIGG 199
                    .:.|:.|.:..:|    |...::..|:...|::.|
 Frog   216 SNTCEVNTKYKAVRTSIYTKH----LERWLKYFPIEQFHIVDG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 23/160 (14%)
hs3st5NP_001120624.1 Sulfotransfer_1 89..329 CDD:366246 26/170 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.