DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and lipc

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001107731.1 Gene:lipc / 100135730 XenbaseID:XB-GENE-955547 Length:496 Species:Xenopus tropicalis


Alignment Length:299 Identity:91/299 - (30%)
Similarity:126/299 - (42%) Gaps:71/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 CQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMC-RGDVNFVIVDAA 157
            ||   :.:.:...|.|.| |::...:||:..||:......|.|..::.||.. :..||.::.|..
 Frog    62 CQ---IQIFQPETLEKCS-FNESLPLVIIIHGWSVDGMLESWIWKMASAFKSQKRQVNVIVADWL 122

  Fly   158 DYVDTFYAWSALNTDLIGEHIGVGLTHL---IELTPLRNIHLIGGFIKESFVSINSGSDFFVGHS 219
            .:....|..:..||.:||..|...|..|   |:. |..|||||                   |:|
 Frog   123 TFAHVHYPIAVQNTRIIGLEIAEFLEWLESSIQF-PRSNIHLI-------------------GYS 167

  Fly   220 LGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT--------N 276
            ||||:.|.||.....|  |.|.||||||||.|.|........|:..||..||.|||        :
 Frog   168 LGAHVSGFAGSYISGL--KKIGRITGLDPAGPLFEGMSSTDRLSPDDANFVDAIHTFTQQHMGLS 230

  Fly   277 IGILAKRGPLGDVDFYPGGAHPIQPGC---------------LTIGCSHTRAVEYFAESAYPHQE 326
            :||   ..|:...||||.|.| .||||               .|:.|:|.|:|..|.:|.. :.:
 Frog   231 VGI---NQPVAHYDFYPNGGH-FQPGCDIKNLIANIGFYGIKETVKCAHERSVHLFIDSLL-NDD 290

  Fly   327 KNFMGKKCA---SWDE-----LRKRDCSAGIVSPMGYRM 357
            |..|...|.   ::|:     .||..|:.     :||.:
 Frog   291 KQSMAYWCKDINTFDKGVCLSCRKNRCNT-----LGYNI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 91/299 (30%)
lipcNP_001107731.1 lipo_lipase 47..492 CDD:132274 91/299 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.