DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and SGPL1

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_003892.2 Gene:SGPL1 / 8879 HGNCID:10817 Length:568 Species:Homo sapiens


Alignment Length:447 Identity:92/447 - (20%)
Similarity:145/447 - (32%) Gaps:144/447 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 W-KILENVFHLLRK--------EDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAE 77
            | :..:..|.|.||        :|.  ::..|.|..|.:.||:.|  ||.:  |...::..|.:.
Human    67 WSRFKKKCFKLTRKMPIIGRKIQDK--LNKTKDDISKNMSFLKVD--KEYV--KALPSQGLSSSA 125

  Fly    78 IEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYE--------------- 127
            :.|..::                 :..:|.|...|     ..:|:.|:.|               
Human   126 VLEKLKE-----------------YSSMDAFWQEG-----RASGTVYSGEEKLTELLVKAYGDFA 168

  Fly   128 --------VAPVFSLIETEVIATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSG 183
                    :.|....||.|::...|.| .|..:..|....||:.|.:  |....|:.....|   
Human   169 WSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESIL--MACKAYRDLAFEK--- 228

  Fly   184 MFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFF 248
              |::...:.....:|.:|.|||::.|:   ..|.|...   :|:..|:.|.   .:|.......
Human   229 --GIKTPEIVAPQSAHAAFNKAASYFGM---KIVRVPLT---KMMEVDVRAM---RRAISRNTAM 282

  Fly   249 VNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERA--------- 304
            :.|:......|..|.:...|.:..::.:.|||||||||         .||..:|:|         
Human   283 LVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGG---------FLIVFMEKAGYPLEHPFD 338

  Fly   305 ------NSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDT------ 357
                  .|.|.:.||...||...||.|                 |..::.:.|....||      
Human   339 FRVKGVTSISADTHKYGYAPKGSSLVL-----------------YSDKKYRNYQFFVDTDWQGGI 386

  Fly   358 -----------GNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKL 403
                       |..|..|         |..|...|...|.......|..||.|:.:|
Human   387 YASPTIAGSRPGGISAAC---------WAALMHFGENGYVEATKQIIKTARFLKSEL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 75/363 (21%)
SGPL1NP_003892.2 DOPA_deC_like 144..507 CDD:99743 72/342 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.