DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and EMB1075

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_175036.1 Gene:EMB1075 / 840958 AraportID:AT1G43710 Length:482 Species:Arabidopsis thaliana


Alignment Length:404 Identity:98/404 - (24%)
Similarity:157/404 - (38%) Gaps:77/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEG 152
            |::...:|     ..|||..|.:..  :.:....|.|.....|    .|..|:....:|...:..
plant   111 YNLDFDYG-----ALGQLQHFSINN--LGDPFIESNYGVHSRP----FEVGVLDWFARLWEIERD 164

  Fly   153 D--GIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYN 215
            |  |.....|:..|::|:::.|     |:...|       :|:.|.|||||..|||....:   .
plant   165 DYWGYITNCGTEGNLHGILVGR-----EMFPDG-------ILYASRESHYSVFKAARMYRM---E 214

  Fly   216 CVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHG----- 275
            |..|.|...|::..|||..|:.   |...:|..:|...||||.||.||::......|..|     
plant   215 CEKVDTLMSGEIDCDDLRKKLL---ANKDKPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDR 276

  Fly   276 LWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTR-ESGRLLERCNST 339
            .::|.|..|.|..:...|....:...:...|.|.:.||.:|.|:.|.:.:|| |..::|    |:
plant   277 FYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL----SS 337

  Fly   340 EAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKF-WLMLKARGYGKYGLMVDHAIHIARLLEGKL 403
            ...||..:|           .::...|...|..| |..|..:||..:...|...:..|..|:.:|
plant   338 NVEYLASRD-----------ATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRL 391

  Fly   404 RQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTL--MIG 466
            |:.|....|    :|.|:...:..||      :||....|            |:|..|.:  ::.
plant   392 REAGISAML----NELSSTVVFERPK------DEEFVRRW------------QLACQGDIAHVVV 434

  Fly   467 YSPLKAKNLGNFFR 480
            ...:..:.|.||.:
plant   435 MPSVTIEKLDNFLK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 96/395 (24%)
EMB1075NP_175036.1 PLN02263 15..482 CDD:177904 98/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D810772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.