DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and hdc

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_005169965.1 Gene:hdc / 793609 ZFINID:ZDB-GENE-080102-5 Length:608 Species:Danio rerio


Alignment Length:403 Identity:97/403 - (24%)
Similarity:178/403 - (44%) Gaps:55/403 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KQKIVPFLQPDKLKELI-NLKVRETENCS--LAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDP 107
            ::::||.:||..::.|: :....|.|:.|  :.::|.:... |:|:.....|.     .|..|:.
Zfish    26 ERRVVPDVQPGFMRPLLPSSAPYEPEDWSTIMQDVENIIMPGVVHWQSPHMHA-----YFPALNS 85

  Fly   108 F-GLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKE----------GDGIFAPGGS 161
            : .|.|.::.:|:|...:|:..:|..:.:|..|:..:||..|..:          |.||.....|
Zfish    86 WPSLLGDMLADAINCLGFTWASSPACTELEMCVLDWLCKALGLPDHYLHHHPQSTGGGILQSTVS 150

  Fly   162 TSNMYGMVLARYKIAPEVKT--------SGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVS 218
            ...:..::.||.....::|:        ..:...| ||.:.||::|.|..||      |..:.|.
Zfish   151 ECTLVALLAARKDRILQMKSEATHTDTDESVLNSR-LVAYASDQAHSSVEKA------GLISLVK 208

  Fly   219 VR---TNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHV 280
            :|   |:....:..:.|:..:.|.:..|..|..|..|.|:|.:.:||.::....|..|.||||||
Zfish   209 IRFLQTDAVFSLRGETLQRAVEEDRRSGLIPVMVCATLGSTGVCSFDRLDELGPVCVREGLWLHV 273

  Fly   281 DACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLF 345
            ||...|:|||..:.|..:.|::.|:||.:||.|.:.....|:.|..:         |..:....|
Zfish   274 DAAYAGSALLCPELRYFLDGIQFADSFVFNPSKWMLVHFDCTAFWVK---------NKMKLQQTF 329

  Fly   346 QQDKFYDVSYDTGNKS------VQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLR 404
            ..|..| :.:|..|.:      :...|:..:.|.|.::::.|..|....:.|.:.:|:|.|..:|
Zfish   330 TVDPLY-LRHDNSNATDFMHWQIPLSRRFRSLKLWFVIRSFGLKKLQEHIRHGVEMAKLFESLVR 393

  Fly   405 QRGDRFRLVIPEH 417
             ....|::....|
Zfish   394 -NDTHFQIPAQRH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 85/349 (24%)
hdcXP_005169965.1 Pyridoxal_deC 35..414 CDD:278699 94/394 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.