DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and Sepsecs

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001121759.1 Gene:Sepsecs / 679383 RGDID:1589491 Length:504 Species:Rattus norvegicus


Alignment Length:384 Identity:79/384 - (20%)
Similarity:122/384 - (31%) Gaps:138/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGLMDDWKILENVFHLLRKE-------DTFCVDPQKWDKQKIVPFLQPDKLKEL----INLKVRE 69
            |.|..|.|.:|.....|..|       .|.|..|:           .||:|:||    .|..:..
  Rat   196 DELRTDLKAVEAKIQELGPEHILCLHSTTACFAPR-----------VPDRLEELAVICANYDIPH 249

  Fly    70 TENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPF----------GLAGALVTEAMNGSTY 124
            ..|.:.......|..:|....:.          |::|.|          .:.||::. ..|.| :
  Rat   250 VVNNAYGLQSSKCMHLIQQGARV----------GRIDVFVQSLDKNFMVPVGGAIIA-GFNDS-F 302

  Fly   125 TYEVAPVF--------SLIETEVIATICKLA--GYKEGDGIFAPGGSTSNMYGMVLARYKIAPEV 179
            ..|::.::        ||   :|:.|:..|.  |||                       |:..|.
  Rat   303 IQEISKMYPGRASASPSL---DVLITLLSLGCNGYK-----------------------KLLKER 341

  Fly   180 KTSGMFGMRPLVLFTSDESHYS-FVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARG 243
            |.  ||......|....|:|.. .:|.       .:|.:|:      .|.|:.|:.....|..:.
  Rat   342 KE--MFAYLSTQLQKLAEAHNERLLKT-------PHNPISL------AMTLETLDGHQDRAVTQL 391

  Fly   244 GEPFFVNCTAGTTV--LGAFDDINGAADVTERHGLWLHVD----ACLGGAALLSAKNRSLIAGLE 302
            |...|....:|...  ||:...::|.   |.| |...|.|    |.|..||.:..|.:.:     
  Rat   392 GSMLFTRQVSGARAVPLGSVQTVSGH---TFR-GFMSHTDNYPCAYLNAAAAIGMKVQDV----- 447

  Fly   303 RANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKS 361
                               .||:.|     |::|.:|...   :|.|...||...|||:
  Rat   448 -------------------DLFIKR-----LDKCLNTVRK---EQRKASAVSGADGNKA 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 60/292 (21%)
SepsecsNP_001121759.1 selenium_SpcS 13..458 CDD:211833 70/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.