DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and Sgpl1

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001303602.1 Gene:Sgpl1 / 20397 MGIID:1261415 Length:568 Species:Mus musculus


Alignment Length:429 Identity:93/429 - (21%)
Similarity:155/429 - (36%) Gaps:108/429 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 W-KILENVFHLLRK--------EDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAE 77
            | :..:.:|.|:||        |..  |...|.|..|.:|||:.||    ..:|....:....||
Mouse    67 WSRFKKKLFKLIRKMPFIGRKIEQQ--VSKAKKDLVKNMPFLKVDK----DYVKTLPAQGMGTAE 125

  Fly    78 IEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGA----------LVTEAMNGSTYTY----EV 128
            :.|..::             ::.:.|.......:||          |:.:|....|::.    ::
Mouse   126 VLERLKE-------------YSSMDGSWQEGKASGAVYNGEPKLTELLVQAYGEFTWSNPLHPDI 177

  Fly   129 APVFSLIETEVIATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYK-IAPEVKTSGMFGMRPLV 191
            .|....:|.|::...|.| .|..:..|....||:.|.:  |....|: :|.|.      |::...
Mouse   178 FPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESIL--MACKAYRDLALEK------GIKTPE 234

  Fly   192 LFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTT 256
            :...:.:|.:|.|||::.|:   ..|.|...:..::.:..::..|:...|      .:.|:....
Mouse   235 IVAPESAHAAFDKAAHYFGM---KIVRVALKKNMEVDVQAMKRAISRNTA------MLVCSTPQF 290

  Fly   257 VLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERA---------------NS 306
            ..|..|.:...|.:..|:.:.|||||||||         .||..:|:|               .|
Mouse   291 PHGVMDPVPEVAKLAVRYKIPLHVDACLGG---------FLIVFMEKAGYPLEKPFDFRVKGVTS 346

  Fly   307 FSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQ-------QDKFYDVSYDTGNKSVQC 364
            .|.:.||...||...|:.:           .|.|.:..:|       |...|......|::.   
Mouse   347 ISADTHKYGYAPKGSSVVM-----------YSNEKYRTYQFFVGADWQGGVYASPSIAGSRP--- 397

  Fly   365 GRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKL 403
            |..|.|  .|..|...|...|.......|..||.|:.:|
Mouse   398 GGIIAA--CWAALMHFGENGYVEATKQIIKTARFLKSEL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 74/345 (21%)
Sgpl1NP_001303602.1 DOPA_deC_like 146..507 CDD:99743 73/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.