DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and DDC

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_000781.2 Gene:DDC / 1644 HGNCID:2719 Length:480 Species:Homo sapiens


Alignment Length:405 Identity:99/405 - (24%)
Similarity:179/405 - (44%) Gaps:77/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QPDKLKELINLKVRETENCSLAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDPFGLA-GALVTE 117
            :||..:::||            ::|::... |.|:         |:..|....|...: .|::.:
Human    49 EPDTFEDIIN------------DVEKIIMPGVTHW---------HSPYFFAYFPTASSYPAMLAD 92

  Fly   118 AMNGST----YTYEVAPVFSLIETEVIATICKL-----------AGYKEGDGIFAPGGSTSNMYG 167
            .:.|:.    :::..:|..:.:||.::..:.|:           ||  ||.|:.....|.:.:..
Human    93 MLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAG--EGGGVIQGSASEATLVA 155

  Fly   168 MVLARYKI-------APEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL-GSYNCVSVRTNER 224
            ::.||.|:       :||:..:.:  |..||.::||::|.|..:|    || |.....::.::..
Human   156 LLAARTKVIHRLQAASPELTQAAI--MEKLVAYSSDQAHSSVERA----GLIGGVKLKAIPSDGN 214

  Fly   225 GQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAAL 289
            ..|....|:..:...||.|..|||:..|.|||...:||::.....:..:..:||||||...|:|.
Human   215 FAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAF 279

  Fly   290 LSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFY--D 352
            :..:.|.|:.|:|.|:||::||||.:.....||....:      :|.:.|.|   |:.|..|  .
Human   280 ICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVK------KRTDLTGA---FRLDPTYLKH 335

  Fly   353 VSYDTG------NKSVQCGRKIDAFKFWLMLKARGYGKYGLM--VDHAIHIARLLEGKLRQRGDR 409
            ...|:|      :..:..||:..:.|.|.:.  |.||..||.  :...:.::...|..:|| ..|
Human   336 SHQDSGLITDYRHWQIPLGRRFRSLKMWFVF--RMYGVKGLQAYIRKHVQLSHEFESLVRQ-DPR 397

  Fly   410 FRLVIPEHEYSNVCF 424
            |.:.: |.....|||
Human   398 FEICV-EVILGLVCF 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 92/362 (25%)
DDCNP_000781.2 Pyridoxal_deC 35..414 CDD:365998 99/405 (24%)
2 X approximate tandem repeats 58..178 24/142 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.