DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and Hdc

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_006498847.1 Gene:Hdc / 15186 MGIID:96062 Length:681 Species:Mus musculus


Alignment Length:383 Identity:94/383 - (24%)
Similarity:169/383 - (44%) Gaps:41/383 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KQKIVPFLQPDKLKELINLKVRE---TENCSLAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDP 107
            ::::.|.:||..|:..:.....|   :.:....:||.:... |:|:.....|.     .:..|..
Mouse    53 ERQVTPNVQPGYLRAQLPASAPEEPDSWDSIFGDIERVIMPGVVHWQSPHMHA-----YYPALTS 112

  Fly   108 F-GLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKE----------GDGIFAPGGS 161
            : .|.|.::.:|:|...:|:..:|..:.:|..::..:.|:.|..|          |.|:.....|
Mouse   113 WPSLLGDMLADAINCLGFTWASSPACTELEMNIMDWLAKMLGLPEYFLHHHPSSRGGGVLQSTVS 177

  Fly   162 TSNMYGMVLAR-YKI------APEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSV 219
            .|.:..::.|| .||      .|:...|.:...  ||.:|||::|.|..||      |..:.|.:
Mouse   178 ESTLIALLAARKNKILAMKACEPDANESSLNAR--LVAYTSDQAHSSVEKA------GLISLVKI 234

  Fly   220 R---TNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVD 281
            |   .::...:..:.|:..|.|.|.:|..|.||..|.|||.:.|||.::....:....|||||||
Mouse   235 RFLPVDDNFSLRGEALQKAIEEDKQQGLVPVFVCATLGTTGVCAFDRLSELGPICASEGLWLHVD 299

  Fly   282 ACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQ 346
            |...|.|.|..:.|..:.|:|.|:||::||.|.:.....|:.|..::..: |::..|....||..
Mouse   300 AAYAGTAFLCPELRGFLEGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYK-LQQTFSVNPIYLRH 363

  Fly   347 QDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLR 404
            .:.  ..:.|..:..:...|:..:.|.|.::::.|.......|.|...:|:..|..:|
Mouse   364 ANS--GAATDFMHWQIPLSRRFRSIKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVR 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 84/329 (26%)
HdcXP_006498847.1 Pyridoxal_deC 62..440 CDD:365998 92/374 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.