DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb6c

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:408 Identity:101/408 - (24%)
Similarity:177/408 - (43%) Gaps:69/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLA----- 88
            ::..:.:|...||||||::.....: :|..::|.|..|.::|...||:|||..||...|:     
Mouse     1 MMDPLLEANATFALNLLKILGEDRS-KNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCS 64

  Fly    89 ------IYVDYPTLRRWYEDVRAYHYLNSEN----TKLFSLRYAYYDDVGDLELVKGYNSVVLEG 143
                  ::..:..|..........:.|.:.|    .|.|.:..::.|...     |.|.:.:.| 
Mouse    65 SSEDGDVHQGFQLLLSEVNKTGTQYSLKAANRLFGEKTFDILASFKDSCH-----KFYEAEMEE- 123

  Fly   144 VGEGNVVLREGRPRGVDFDQGAS----IIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYF 204
                           :|| :||:    ..||..:.|.:..||....|..:.:|...::.:...||
Mouse   124 ---------------LDF-KGATEQSRQHINTWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYF 172

  Fly   205 KAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQ--TGKYAYVNNVKGLQADVLELPFGEHELVM 267
            |.||:..|:|..|: |..:....:....|:||.|  |.|..||..:   ...:|.||:..:||.|
Mouse   173 KGKWEKQFNKEDTR-EMPFKVSKNEEKPVQMMFQKSTFKMTYVEEI---STKILLLPYVGNELNM 233

  Fly   268 IVILPKPSQRVSLVLKQLKNLGLHRLLE--ELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGL 330
            |::||.....:|.|.|::.:   .:.:|  .|:..|.|. |||.||.|.......::|.:.:.|:
Mouse   234 IIMLPDEHVELSTVEKEITH---EKFIEWTRLDRMKGEK-VEVFLPWFKLEENYDMKDVLCKLGM 294

  Fly   331 TDL----RNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEG----LPNAVPQKSSGTNNIKFH 387
            ||.    |.:|:.:      :..:|.:||.....:.:.|:|||    ....:..|.|..:...|.
Mouse   295 TDAFEEGRADFSGI------SSKQGLFLSNVIHKSVVEVNEEGSEATAATTIVLKGSSRSTPCFC 353

  Fly   388 INRPFAYLVLQ-RTHKLL 404
            :||||.:.:.. :|:::|
Mouse   354 VNRPFIFFIQHIKTNEIL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 101/401 (25%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 101/407 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.