DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINH1

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:409 Identity:91/409 - (22%)
Similarity:149/409 - (36%) Gaps:120/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDVRA 105
            |.:|.|..:....:||..::|....|.:.:...|.:.||..|.:.||:.    ..||.  |:|.|
Human    51 AFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSA----EQLRD--EEVHA 109

  Fly   106 YHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQG------ 164
                                                 |:||....|.....|.|.:..|      
Human   110 -------------------------------------GLGELLRSLSNSTARNVTWKLGSRLYGP 137

  Fly   165 ASIIINDDIDKAS-------HAKIFSSYSRRSFNS----------------------TVTVLGIT 200
            :|:...||..::|       |:||.....|.:..|                      |...|.:.
Human   138 SSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKLPEVTKDVERTDGALLVN 202

  Fly   201 VSYFKAKWKYPF-----DKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPF 260
            ..:||..|...|     |.....|.:.|..|      |.||.:||.|.|.::.|. :..::|:|.
Human   203 AMFFKPHWDEKFHHKMVDNRGFMVTRSYTVG------VMMMHRTGLYNYYDDEKE-KLQIVEMPL 260

  Fly   261 GEHELVMIVILP---KPSQRVSLVLKQLKNLGLHRLLEELE---ASKNESDVEVKLPKFDTRSVL 319
            ......:|:::|   :|.:|:..:|.:          |:|:   ....:..|.:.|||.......
Human   261 AHKLSSLIILMPHHVEPLERLEKLLTK----------EQLKIWMGKMQKKAVAISLPKGVVEVTH 315

  Fly   320 SLEDTVYEAGLTDL--RNEFADLGRMLIPTGDRGAYL-SLYHQFARIVVDEEGLPNAVPQKSSGT 381
            .|:..:...|||:.  :|: |||.||   :|.:..|| |::|..| ..:|.:|  |...|...|.
Human   316 DLQKHLAGLGLTEAIDKNK-ADLSRM---SGKKDLYLASVFHATA-FELDTDG--NPFDQDIYGR 373

  Fly   382 NNIK----FHINRPFAYLV 396
            ..::    |:.:.||.:||
Human   374 EELRSPKLFYADHPFIFLV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 91/409 (22%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 91/409 (22%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.