DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINA6

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:378 Identity:86/378 - (22%)
Similarity:161/378 - (42%) Gaps:43/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MTDARLQFALNLLQMESTHL----NLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDY 93
            :..|.:.||.:|.:    ||    ..:|..::|.|....:.|...|..|.|..|:...|...:..
Human    39 LASANVDFAFSLYK----HLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTE 99

  Fly    94 PTLRRWYEDVRAYHYL--NSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRP 156
            .:....::..:..|.|  .|:.:...::..|.:.| |.|||::.: |..::...|..|:      
Human   100 RSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLD-GSLELLESF-SADIKHYYESEVL------ 156

  Fly   157 RGVDFDQ--GASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKV 219
             .::|..  .||..||..:...:..||...:|  ..:|...::.:...:||..|..|||.:.|:.
Human   157 -AMNFQDWATASRQINSYVKNKTQGKIVDLFS--GLDSPAILVLVNYIFFKGTWTQPFDLASTRE 218

  Fly   220 EQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQ 284
            |.|| ...:...||.||:|:...:|:::.: |...::::.:..:..|..::..|  .:::.|:..
Human   219 ENFY-VDETTVVKVPMMLQSSTISYLHDSE-LPCQLVQMNYVGNGTVFFILPDK--GKMNTVIAA 279

  Fly   285 LKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGD 349
            |....::|    ..|....|.|::.:||.....|..|.|.:.|.|:.||....|:..|:   |.|
Human   280 LSRDTINR----WSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRI---TQD 337

  Fly   350 RGAYLSLYHQFARIVVDEEGLPNAVPQKSSG------TNNIKFHINRPFAYLV 396
            .....|.....|.:.::|||:..|   .|:|      :..|....|:||..::
Human   338 AQLKSSKVVHKAVLQLNEEGVDTA---GSTGVTLNLTSKPIILRFNQPFIIMI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 86/375 (23%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 86/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.