DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SRP3

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:288 Identity:63/288 - (21%)
Similarity:100/288 - (34%) Gaps:80/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VDFDQGASII---INDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVE 220
            |||...|..:   :|..::..::..|.......|..|....:......||..||.||:|..|:..
plant   126 VDFRSEAEEVRKEVNSWVEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDN 190

  Fly   221 QFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPF------GEHELVMIVILPKPSQRVS 279
            .||...|:.. .|..| .:.:..||....|.:  ||.||:      ...:..|...||.      
plant   191 DFYLVNGTSV-SVPFM-SSYENQYVRAYDGFK--VLRLPYQRGSDDTNRKFSMYFYLPD------ 245

  Fly   280 LVLKQLKNLGLHRLLEELEASKNESDVEV----------KLPKFDTRSVLSLEDTVYEAGLTDLR 334
                  |..||..|||::.::....|..:          ::|||......|:...:...||..  
plant   246 ------KKDGLDDLLEKMASTPGFLDSHIPTYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRS-- 302

  Fly   335 NEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAV----------------PQKSSGTNN 383
                               :|:||: |.:.:||||...|.                |:|      
plant   303 -------------------MSMYHK-ACVEIDEEGAEAAAATADGDCGCSLDFVEPPKK------ 341

  Fly   384 IKFHINRPFAYLVL-QRTHKLLIHSGVF 410
            |.|..:.||.:|:. ::|..:|....:|
plant   342 IDFVADHPFLFLIREEKTGTVLFVGQIF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 62/286 (22%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 63/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.