DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and AT3G45220

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:420 Identity:97/420 - (23%)
Similarity:154/420 - (36%) Gaps:82/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYP 94
            ::..||..:..|.:::   .|..|..|...:|.|...|:.:...|:...|.:||...:.:     
plant     7 MENQTDVMVLLAKHVI---PTVANGSNLVFSPMSINVLLCLIAAGSNCVTKEQILSFIML----- 63

  Fly    95 TLRRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGV-----------GEGN 148
                     .:..|||:...|..|:......:..||.|...|...:.:.:           ...|
plant    64 ---------PSSDYLNAVLAKTVSVALNDGMERSDLHLSTAYGVWIDKSLSFKPSFKDLLENSYN 119

  Fly   149 VVLREGRPRGVDFDQGASIIINDDIDKAS-HA-----KIFSSYSRRSFNSTVTVLGITVSYFKAK 207
            ....:     |||....:.:||:....|. |.     :|.|..|.::...::.:|...| |||..
plant   120 ATCNQ-----VDFATKPAEVINEVNAWAEVHTNGLIKEILSDDSIKTIRESMLILANAV-YFKGA 178

  Fly   208 WKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGE--HELVMIVI 270
            |...||...||...|:...|:.. ||..|... |..|:....|.:  ||.||:.|  .:..|.:.
plant   179 WSKKFDAKLTKSYDFHLLDGTMV-KVPFMTNY-KKQYLEYYDGFK--VLRLPYVEDQRQFAMYIY 239

  Fly   271 LPKPSQRVSLVLKQLKNLGLHRLLEELEASKNESDVEV----------KLPKFDTRSVLSLEDTV 325
            ||....            ||..||||:.:.....|..:          |:|||.........|.:
plant   240 LPNDRD------------GLPTLLEEISSKPRFLDNHIPRQRILTEAFKIPKFKFSFEFKASDVL 292

  Fly   326 YEAGLTDLRNEFADLGRML----IPTG---DRGAYLS-LYHQFARIVVDEEGLPNAVPQKSSGTN 382
            .|.||| |......|..|:    ||..   ....::| ::|: |.|.|||||...|....:|.|.
plant   293 KEMGLT-LPFTHGSLTEMVESPSIPENLCVAENLFVSNVFHK-ACIEVDEEGTEAAAVSVASMTK 355

  Fly   383 NI----KFHINRPFAYLVLQRTHKLLIHSG 408
            ::    .|..:.||.:.|.:....:::..|
plant   356 DMLLMGDFVADHPFLFTVREEKSGVILFMG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 95/414 (23%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 97/419 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.