DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and AT2G35580

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:275 Identity:60/275 - (21%)
Similarity:109/275 - (39%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VDFDQGASII---INDDIDKASHAKIFSSYSRRSFNSTVT-VLGITVSYFKAKWKYPFDKSQTKV 219
            |||...|..:   :|..::|.::..|.:.......::.:| .:.....:|..:|...||.|.||.
plant   125 VDFRTKADEVNREVNSWVEKQTNGLITNLLPSNPKSAPLTDHIFANALFFNGRWDSQFDPSLTKD 189

  Fly   220 EQFYNAGGSPAGKVEMMVQTG---KYAYVNNVKGLQADVLELPFGEHE---LVMIVILPKPSQRV 278
            ..|:...|:   ||.:...||   :|.:|  .:|.:...|:...|..:   ..|.:.||.....:
plant   190 SDFHLLDGT---KVRVPFMTGASCRYTHV--YEGFKVINLQYRRGREDSRSFSMQIYLPDEKDGL 249

  Fly   279 SLVLKQLKNLGLHRLLEELEASKNESDV--EVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLG 341
            ..:|::|.:  ....|::.|...:.|.|  |:|:|:|..       |..:||  ::....|.   
plant   250 PSMLERLAS--TRGFLKDNEVLPSHSAVIKELKIPRFKF-------DFAFEA--SEALKGFG--- 300

  Fly   342 RMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAV-------------PQKSSGTNNIKFHINRPFA 393
             :::|       ||:....:.|.|||.|...|.             |:|..      |..:.||.
plant   301 -LVVP-------LSMIMHKSCIEVDEVGSKAAAAAAFRGIGCRRPPPEKHD------FVADHPFL 351

  Fly   394 YLVLQRTHKLLIHSG 408
            ::|.:....|::..|
plant   352 FIVKEYRSGLVLFLG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 60/275 (22%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 60/275 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.