DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and AT2G26390

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_180207.1 Gene:AT2G26390 / 817179 AraportID:AT2G26390 Length:389 Species:Arabidopsis thaliana


Alignment Length:238 Identity:64/238 - (26%)
Similarity:103/238 - (43%) Gaps:40/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 NSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADV 255
            |||: :|...| ||||.|...||...||...|:...|:.. ||..|: :.|..|:....|.|  |
plant   164 NSTL-ILANAV-YFKAAWSRKFDAKLTKDNDFHLLDGNTV-KVPFMM-SYKDQYLRGYDGFQ--V 222

  Fly   256 LELPFGE--HELVMIVILPKPSQRVSLVLKQL--------KNLGLHRLLEELEASKNESDVE-VK 309
            |.||:.|  ....|.:.||.....::.:|:::        .::.|||           :.|: ::
plant   223 LRLPYVEDKRHFSMYIYLPNDKDGLAALLEKISTEPGFLDSHIPLHR-----------TPVDALR 276

  Fly   310 LPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRML-IPT-GDRGAYLSLYHQFARIVVDEEGLPN 372
            :||.:........:.:.:.|||.......:|..|: .|: ||:....|:.|: |.|.|||||...
plant   277 IPKLNFSFEFKASEVLKDMGLTSPFTSKGNLTEMVDSPSNGDKLHVSSIIHK-ACIEVDEEGTEA 340

  Fly   373 A-------VPQKSSGTNNIKFHINRPFAYLVLQRTHKLLIHSG 408
            |       :||  ....|..|..:.||.:.|.:....:::..|
plant   341 AAVSVAIMMPQ--CLMRNPDFVADHPFLFTVREDNSGVILFIG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 64/238 (27%)
AT2G26390NP_180207.1 serpinP_plants 8..386 CDD:381001 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.