DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SRP2

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:399 Identity:90/399 - (22%)
Similarity:152/399 - (38%) Gaps:125/399 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TLKQIRDVLAIYVDYPTLRRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEG 143
            ::..:..|.|...|..|||.:     ...:|.|.:|:..:   |.:.::.         |||.:.
plant    65 SINAVLTVTAANTDNKTLRSF-----ILSFLKSSSTEETN---AIFHELA---------SVVFKD 112

  Fly   144 VGEGNVVLREGRPR-----GVDFDQGASIIINDDID-------KASHAKI------------FSS 184
            ..|      .|.|:     ||..:|  |:..|.|.:       |||.||:            .::
plant   113 GSE------TGGPKIAAVNGVWMEQ--SLSCNPDWEDLFLNFFKASFAKVDFRHKAEEVRLDVNT 169

  Fly   185 YSRRSFNSTV-------TVLGIT------VSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMM 236
            ::.|..|..:       :|..:|      ..|||..|:..||||.|:.:.|:...|... .|..|
plant   170 WASRHTNDLIKEILPRGSVTSLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLLNGKSV-SVPFM 233

  Fly   237 VQTGKYAYVNNVKGLQADVLELPFGE------HELVMIVILPKPSQRVSLVLKQL-KNLGLHRLL 294
             ::.:..::....|.:  ||.||:.:      .|..|.:.||.....:..:|::: .|.|.    
plant   234 -RSYEKQFIEAYDGFK--VLRLPYRQGRDDTNREFSMYLYLPDKKGELDNLLERITSNPGF---- 291

  Fly   295 EELEASKNESDVEV---KLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLSL 356
              |::...|..|:|   ::|||..       :..:||  :.:.|:| :|...|            
plant   292 --LDSHIPEYRVDVGDFRIPKFKI-------EFGFEA--SSVFNDF-ELNVSL------------ 332

  Fly   357 YHQFARIVVDEEGLPNAV--------------PQKSSGTNNIKFHINRPFAYLVLQ-RTHKLLIH 406
             ||.|.|.:||||...|.              |:|     .|.|..:.||.:|:.: :|..||..
plant   333 -HQKALIEIDEEGTEAAAATTVVVVTGSCLWEPKK-----KIDFVADHPFLFLIREDKTGTLLFA 391

  Fly   407 SGVFREGEI 415
            ..:|...|:
plant   392 GQIFDPSEL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 88/392 (22%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 89/394 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.