DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpind1

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:394 Identity:90/394 - (22%)
Similarity:163/394 - (41%) Gaps:34/394 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KSLLQKMTDARLQFALNLLQ-MESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIY 90
            ||.:|::.....:||.||.: ::....:.:|..:.|....:.|.|...|..|.|.:::..||. :
  Rat   100 KSRIQRLNILNAKFAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLH-F 163

  Fly    91 VDYPTLRRWYEDVRAYHYLNSENTKLFSLRYAY-YDDVGDLELVKGYNSVVLEGVGEGNVVLRE- 153
            .|:......||....::.......:||...:.| ...|.||.:.|.:  .:.|   :....:|| 
  Rat   164 KDFVNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQF--PIRE---DFKAAMREF 223

  Fly   154 --GRPRGVDFDQGASII-INDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKS 215
              ...:..||...|.|. .|..|.|.:...|  ..:..:.:|...::.:...|||..|...|...
  Rat   224 YFAEAQEADFSDPAFISKANSHILKLTKGLI--KEALENTDSATQMMILNCIYFKGAWMNKFPVE 286

  Fly   216 QTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPF--GEHELVMIVILPKPSQRV 278
            .|....| ........||.||...|.:...|: :.|..|:|:|.:  |   :.|::::|:....:
  Rat   287 MTHNHNF-RLNEREVVKVSMMQTKGNFLAAND-QELDCDILQLEYVGG---ISMLIVIPRKLSGM 346

  Fly   279 SLVLKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRM 343
            ..:..||    ..:::|..:.|......||.||||......:|.:.:...|:|.|.|:..::..:
  Rat   347 KTLEAQL----TPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI 407

  Fly   344 LIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSSG----TNNIKFHINRPFAYLVLQRTHKLL 404
                .|:...:.|:...:.|.|:||| ..|....:.|    :..::|.::|||.:||.:.....|
  Rat   408 ----SDQRIIIDLFKHQSTITVNEEG-TQAAAVTTVGFMPLSTQVRFTVDRPFLFLVYEHRTSCL 467

  Fly   405 IHSG 408
            :..|
  Rat   468 LFMG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 87/385 (23%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 90/394 (23%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.