DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb12

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:324 Identity:83/324 - (25%)
Similarity:143/324 - (44%) Gaps:49/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RAYHYLNSEN----TKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQG 164
            ::|:.|:..|    .:.|.:...|.|||.:.     :::.|                ..|||.:.
Mouse   125 KSYYTLSMANRLYGEQEFPICSEYSDDVTEF-----FHTTV----------------ESVDFQKD 168

  Fly   165 ASII---INDDIDKASHAKIFSSYSRRSF-NSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNA 225
            :...   ||..::..|..||...:.:.:. ||||.|| :...||||||:..|: |:..|:..:..
Mouse   169 SEKSRQEINFWVESQSQGKIKELFGKEAIDNSTVLVL-VNAVYFKAKWEREFN-SENTVDASFCL 231

  Fly   226 GGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGL 290
            ..:....|:||.|.||:. :..:..|||.:||:.:...:|.|:|:||..|:.....|::|:....
Mouse   232 NENEKKTVKMMNQKGKFR-IGFIDELQAQILEMKYAMGKLSMLVLLPSCSEDNVNSLQELEKKIN 295

  Fly   291 HRLLEELEASKN--ESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEF-ADLGRMLIPTG---D 349
            |..|....:|:|  |..|.:..|:|:......|:..:.:.|:.|:.:|. |||      ||   .
Mouse   296 HEKLLAWSSSENLSEKPVAISFPQFNLEDSYDLKSILQDMGIKDVFDETKADL------TGISKS 354

  Fly   350 RGAYLSLYHQFARIVVDEEGLPNA-----VPQKSSGTNNIKFHINRPFAYLVLQRTHKLLIHSG 408
            ...|||.......:.|||.|...|     |..:.:..:.::|:.|.||.:.:.....:.|:..|
Mouse   355 PNLYLSKIVHKTFVEVDEMGTQAAAASGVVAAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 83/324 (26%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 83/324 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.