DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpine3

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:415 Identity:95/415 - (22%)
Similarity:156/415 - (37%) Gaps:110/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLQFALNLLQMESTHLNLENFAMTPFS-TWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWY 100
            :.:|||:|.|..:...|..||.::|.| :.||.|:.: .|.|.|..|:.:.|...|..|.:|.:.
  Rat    32 KTEFALHLYQSAAAETNGTNFVISPASVSLSLEILQF-AARGNTGWQLAEALGYTVQDPRVREFL 95

  Fly   101 EDVRAYHYLNSENTK----------LF-----SLRYAYYDDV-----GDLELV--KGYNSVVLE- 142
            ..|    |:...|:.          ||     ||...:.:.|     ..|||.  ...|:..:| 
  Rat    96 HTV----YITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEPNTTTMEA 156

  Fly   143 -------GVGEGNVVLREGRP---RGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVL 197
                   ..|||     .|.|   |........||:                       ||:|  
  Rat   157 SKGTTRPSTGEG-----PGSPLWGRAGALSTQLSIV-----------------------STMT-- 191

  Fly   198 GITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAY--VNNVKGLQADVLELPF 260
                  |::.|:..|.....:...|..|.|... :|..|.|..:.:|  ..:..|.:.|||||.:
  Rat   192 ------FQSSWQQRFSSVALQPLPFTCAHGLVL-QVPAMHQVAEVSYGQFQDAAGHKVDVLELLY 249

  Fly   261 GEHELVMIVILPK----PSQRVSLVLKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSL 321
            ......::::||:    |...:.   ..|....:|.....|:.::    ::|.||:|..::...|
  Rat   250 LGRVASLLLVLPQDKGTPLDHIE---PHLTARVIHLWTTRLKRAR----MDVFLPRFRIQNQFDL 307

  Fly   322 EDTVYEAGLTDLRNEF-ADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSSGTNNI- 384
            :..:...|:|||.:.. |:|..:   :|..|.|:|.....|::.:.|||      .||.....: 
  Rat   308 KSILRSWGITDLFDPLKANLKGI---SGRDGFYVSEVTHKAKMELSEEG------TKSCAATAVL 363

  Fly   385 --------KFHINRPFAYLVLQRTH 401
                    .|..:|||.:|:  |.|
  Rat   364 LLRRSRTPAFKADRPFIFLL--REH 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 95/415 (23%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 95/415 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.