DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb1a

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_079705.2 Gene:Serpinb1a / 66222 MGIID:1913472 Length:379 Species:Mus musculus


Alignment Length:392 Identity:99/392 - (25%)
Similarity:166/392 - (42%) Gaps:55/392 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYP 94
            :::::.|...|||.|.|..:......|...:|||..|.:.|...||:|:|..|:..  ..:.|. 
Mouse     1 MEQLSSANTLFALELFQTLNESSPTGNIFFSPFSISSALAMVILGAKGSTAAQLSK--TFHFDS- 62

  Fly    95 TLRRWYEDVRA-YHYLNSENTK-----LFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLRE 153
                 .||:.: :..||:|.:|     ...|....|.:       |.||.:.........:...:
Mouse    63 -----VEDIHSRFQSLNAEVSKRGASHTLKLANRLYGE-------KTYNFLPEYLASTQKMYGAD 115

  Fly   154 GRPRGVDF---DQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKS 215
            ..|  |||   .:.|...||..:...:..||....|....:|...::.:...|||..|:..|...
Mouse   116 LAP--VDFLHASEDARKEINQWVKGQTEGKIPELLSVGVVDSMTKLVLVNAIYFKGMWEEKFMTE 178

  Fly   216 QTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSL 280
            .| .:..:.........|:||.|..|:.: ..:..|:..|||:|:...||.|:::|||..:..|.
Mouse   179 DT-TDAPFRLSKKDTKTVKMMYQKKKFPF-GYISDLKCKVLEMPYQGGELSMVILLPKDIEDEST 241

  Fly   281 VLKQL-KNLGLHRLLEELEASKNES----DVEVKLPKFDTRSVLSLEDTVYEAGLTDL-RNEFAD 339
            .||:: |.:.|.:|   ||.:|.|:    ||.||||:|......:|...:...|:.|| .:..||
Mouse   242 GLKKIEKQITLEKL---LEWTKRENLEFIDVHVKLPRFKIEESYTLNSNLGRLGVQDLFSSSKAD 303

  Fly   340 LGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSSGTNNI----------KFHINRPFAY 394
            |..|   :|.|..::|.....:.:.|:|||     .:.::.|..|          :|.::.||.:
Mouse   304 LSGM---SGSRDLFISKIVHKSFVEVNEEG-----TEAAAATGGIATFCMLLPEEEFTVDHPFIF 360

  Fly   395 LV 396
            .:
Mouse   361 FI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 99/386 (26%)
Serpinb1aNP_079705.2 serpinB1_LEI 1..379 CDD:381028 99/392 (25%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 351..379 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.