DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina5

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:392 Identity:86/392 - (21%)
Similarity:163/392 - (41%) Gaps:52/392 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRR 98
            |.....||..|.:..::....:|...:|.|....:.|...|:...|..||.:.|.:     :|::
  Rat    77 TSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGL-----SLQQ 136

  Fly    99 WYEDV--RAYHYL------NSENTKLFSLRYAYYDD----VGDLELVKGYNSVVLEGVGEGNVVL 151
            ..||:  :.:..|      .|:..:| ||..|.:.|    :.| ..:....::.:..:...|.  
  Rat   137 GQEDMLHKGFQQLLQQFSQPSDGLQL-SLGSALFTDPAVHIRD-HFLSAMKTLYMSDMFSTNF-- 197

  Fly   152 REGRPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQ 216
              |.|      :.|...|||.:.|.::.||....  :..:||..::.:...:|||||:..|..:.
  Rat   198 --GNP------ESAKKQINDYVAKKTNGKIVDLI--KDLDSTHVMVVVNYIFFKAKWQTAFSSTN 252

  Fly   217 T-KVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSL 280
            | |::  |:.......:|.||.:...|:|:.: :.:...|:.:|: :.....:.|||...:    
  Rat   253 THKMD--YHVTPKKTIQVPMMNREDIYSYILD-QNISCTVVGIPY-QGNTFALFILPSEGK---- 309

  Fly   281 VLKQLKNLGL-HRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRML 344
             :|:::: || .|.|........:..:::.||||.......||..:.:.|:.|:....|||..: 
  Rat   310 -MKRVED-GLDERTLRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSGL- 371

  Fly   345 IPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQ------KSSGTNNIKFHINRPFAYLVLQRTHKL 403
              |......||.....:.:.|||.|...|...      :|:..:::|....|||..:::..|:..
  Rat   372 --TDHTNIKLSEMVHKSMVEVDESGTTAAASTGILFTLRSARPSSLKVEFTRPFLVVIMDGTNLY 434

  Fly   404 LI 405
            .|
  Rat   435 FI 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 85/390 (22%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 85/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.