DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina3i

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:416 Identity:100/416 - (24%)
Similarity:161/416 - (38%) Gaps:61/416 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DTKSLLQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAI 89
            |:.::....||    ||.:|.:........||...:|||.::.:.:...||:..|||:|.:.|..
Mouse    68 DSLTVASSNTD----FAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKF 128

  Fly    90 -YVDYPTLRRWYEDV-RAYHYLNSENTKLFSLRYAYYDDV----GDLELVKGYNSVVLEGVGEGN 148
             ..:.|.     .|: :.:.|       |..|.....|.|    |....|:.:..::.| ..|..
Mouse   129 NLTETPE-----PDIHQGFRY-------LLDLLSQPGDQVQISTGSALFVEKHLQILAE-FKEKA 180

  Fly   149 VVLREGRPRGVDFDQ--GASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFK------ 205
            ..|.:......||.|  .|..:|||.:...:..||....|... .||:.|| :...|||      
Mouse   181 RALYQAEAFTADFLQPCQAKKLINDYVSNQTQGKIKELISDLD-KSTLMVL-VNYIYFKGGRGHC 243

  Fly   206 --------AKWKYPFDKSQTKVEQFYNAGGSPAGKVEMM-VQTGKYAYVNNVKGLQADVLELPFG 261
                    .|||.|||...|...:|| .....:.||.|| ::.....|..:.: |...|:||.:.
Mouse   244 LGVEREELGKWKMPFDPRDTFNSKFY-LDEKRSVKVPMMKIEELTTPYFRDDE-LSCSVVELKYT 306

  Fly   262 EHELVMIVILPKPSQ-RVSLVLKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTV 325
            .:...:.::   |.| ::..|...|....|.:....|:.|:..   |:.||||...:..|||..:
Mouse   307 GNASALFIL---PDQGKMQQVETSLHPETLRKWKNSLKPSRIS---ELHLPKFSISNDYSLEHVL 365

  Fly   326 YEAGLTDLRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNA------VPQKSSGTNNI 384
            ...|:.::.:..|||..:   ||.....:|.....|.:.|.|.|...|      |..:.....::
Mouse   366 PVLGIREVFSMQADLSAI---TGTMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSM 427

  Fly   385 KFHINRPFAYLVLQ-RTHKLLIHSGV 409
            ..:..|||..::.. .||..|..:.|
Mouse   428 TIYFKRPFLIIISDINTHIALFMAKV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 97/405 (24%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 100/416 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.