DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINB9

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:424 Identity:101/424 - (23%)
Similarity:166/424 - (39%) Gaps:94/424 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYP 94
            ::.:::|...||:.||::........|...:|.|..|.:.|...||:|.|..|:...|::..:  
Human     1 METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTE-- 63

  Fly    95 TLRRWYEDV-RAYHYLNSENTKL---FSLRYA----------------------YYDDVGDLELV 133
                  ||: ||:..|.:|..|.   :.||.|                      |:.::.:|..:
Human    64 ------EDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFI 122

  Fly   134 KGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLG 198
            :               ...|.|..           ||..:.|.:..||.......|.::...::.
Human   123 R---------------AAEESRKH-----------INTWVSKKTEGKIEELLPGSSIDAETRLVL 161

  Fly   199 ITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQ--TGKYAYVNNVKGLQADVLELPFG 261
            :...|||.||..|||::.|: |..:.........|:||.|  |.|.|:|..|:   |.:||||:.
Human   162 VNAIYFKGKWNEPFDETYTR-EMPFKINQEEQRPVQMMYQEATFKLAHVGEVR---AQLLELPYA 222

  Fly   262 EHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEA-----SKNESDVEVKLPKFDTRSVLSL 321
            ..||.::|:||.....:|.|.|.|       ..|:|.|     ....::|||.||||..:....:
Human   223 RKELSLLVLLPDDGVELSTVEKSL-------TFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM 280

  Fly   322 EDTVYEAGLTD-LRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQK-------- 377
            |..:...|:.| .:...|||..|   :.:|...||.:...:.:.|:|||...|....        
Human   281 ESVLRHLGIVDAFQQGKADLSAM---SAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECC 342

  Fly   378 -SSGTNNIKFHINRPFAYLVLQRTHKLLIHSGVF 410
             .||.   :|..:.||.:.:.......::..|.|
Human   343 MESGP---RFCADHPFLFFIRHNRANSILFCGRF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 100/416 (24%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 101/421 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.