DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINB8

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:395 Identity:94/395 - (23%)
Similarity:161/395 - (40%) Gaps:56/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYP 94
            :..:.:|...||::|.::.....|..|...:|.|..|.:.|.:.||:|:|..|:...|.:|.| .
Human     1 MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKD-G 64

  Fly    95 TLRRWYEDV------RAYHYLNSENTKLFSLRYAYYDDVGDL-ELVKGYNSVVLE--GVGEGNVV 150
            .:.|.::.:      ....||.....:||..:..  |.:.|. |..:.:....||  ...|....
Human    65 DIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTC--DFLPDFKEYCQKFYQAELEELSFAEDTEE 127

  Fly   151 LREGRPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKS 215
            .|:.              |||.:.:.:..||.......:.:....::.:...|||.||...||:.
Human   128 CRKH--------------INDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRK 178

  Fly   216 QTKVEQFYNAGGSPAGKVEMMVQTGKY--AYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRV 278
            .|:...|..  ......|:||.:..|:  .|.:.|   ...|||||:.|.||.|:::||..:..:
Human   179 YTRGMLFKT--NEEKKTVQMMFKEAKFKMGYADEV---HTQVLELPYVEEELSMVILLPDDNTDL 238

  Fly   279 SLVLKQLKNLGLHRLLEELEASKN-----ESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEF- 337
            ::|.|.|       ..|:.:|..|     :|.|:|.||:........||..:...|:.|..:|. 
Human   239 AVVEKAL-------TYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAK 296

  Fly   338 ADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQ---KSSGTNNI--KFHINRPFAYLVL 397
            ||...|   :.::...||.......:.|:|||...|...   ::|..:.:  :|..:.||.:.: 
Human   297 ADFSGM---STEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFI- 357

  Fly   398 QRTHK 402
             |.||
Human   358 -RHHK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 94/389 (24%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 94/392 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.