DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINE2

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens


Alignment Length:363 Identity:84/363 - (23%)
Similarity:148/363 - (40%) Gaps:51/363 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDVRAYHYLNSENTKLFSL 119
            :|..::|....|::.|...||:|.|.||:..|:...|:           .....|...|..:.|.
Human    61 DNIVISPHGIASVLGMLQLGADGRTKKQLAMVMRYGVN-----------GVGKILKKINKAIVSK 114

  Fly   120 RYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASII--INDDIDKASHAKIF 182
            :......|.:...||..:.:.:..|.....|. :...|.|:|:..||..  ||..:...:...|.
Human   115 KNKDIVTVANAVFVKNASEIEVPFVTRNKDVF-QCEVRNVNFEDPASACDSINAWVKNETRDMID 178

  Fly   183 SSYSRRSFNSTVT-VLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQ-----TGK 241
            :..|....:..:| ::.:...|||..||..|....||...|..|.|. :.:|.|:.|     .|.
Human   179 NLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGK-SYQVPMLAQLSVFRCGS 242

  Fly   242 YAYVNNVKGLQADVLELPFGEHELVMIVILP-KPSQRVSLVLKQLKNLGLHRLLEELEASKNESD 305
            .:..|:   |..:.:|||:....:.|::.|| :.|..:|.::..:....:...:..:...:    
Human   243 TSAPND---LWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKR---- 300

  Fly   306 VEVKLPKFDTRSVLSLEDTVYEAGLTDL----RNEFADLGRMLIPTGDRGAYLSLYHQFARIVVD 366
            |:|.||||...:...|::.:...|:||:    :..||.     |.||....::|...|.|:|.|.
Human   301 VQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAK-----ITTGSENLHVSHILQKAKIEVS 360

  Fly   367 EEGLPNAVPQKSSGTNNIK--------FHINRPFAYLV 396
            |:|     .:.|:.|..|.        |.::|||.:.:
Human   361 EDG-----TKASAATTAILIARSSPPWFIVDRPFLFFI 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 84/363 (23%)
SERPINE2XP_005246698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.