DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINA5

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:376 Identity:83/376 - (22%)
Similarity:153/376 - (40%) Gaps:40/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWY 100
            :|..|..:|.:..::....::...:|.|....:.|...||..:|..||.:.|.:.:...:.:..:
Human    44 SRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELH 108

  Fly   101 EDVRAYHYLNSENTK-----LFSLRYAYYDD-VGDLE--LVKGYNSVVLEGVGEGNVVLREGRPR 157
               |.:..|..|..:     ..||..|.:.| |.||:  .|....:          :.|.:..|.
Human   109 ---RGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKT----------LYLADTFPT 160

  Fly   158 GVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQF 222
            ......||...|||.:.|.:..||....  ::.:|...|:.:...:|||||:..|:...|:.:.|
Human   161 NFRDSAGAMKQINDYVAKQTKGKIVDLL--KNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDF 223

  Fly   223 YNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKN 287
            | .......:|.||.:..:|.|:.: :.|...|:.:|: :.....:.|||...:     ::|::|
Human   224 Y-VTSETVVRVPMMSREDQYHYLLD-RNLSCRVVGVPY-QGNATALFILPSEGK-----MQQVEN 280

  Fly   288 LGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGA 352
            ....:.|.:......:..:|:.||||.......||..:...|::::....|||..  |.......
Human   281 GLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSG--ISNHSNIQ 343

  Fly   353 YLSLYHQFARIVVDEEGLPNAVPQ------KSSGTNNIKFHINRPFAYLVL 397
            ...:.|: |.:.|||.|...|...      :|:..|:.:...||||...::
Human   344 VSEMVHK-AVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIV 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 83/376 (22%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 83/376 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.