DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb3a

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006249702.1 Gene:Serpinb3a / 498209 RGDID:1562868 Length:387 Species:Rattus norvegicus


Alignment Length:422 Identity:96/422 - (22%)
Similarity:171/422 - (40%) Gaps:95/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ARLQFALNLL-QMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRW 99
            |..||.|.|. |:..:.   :|...:|.|..:.:.|...||:|.|.|||..|:..   :.|.::.
  Rat     7 ATTQFTLELYRQLRDSE---DNIFYSPLSIMTALAMLQLGAKGNTEKQIEKVIQF---HETTKKT 65

  Fly   100 YE------DVRAYHY-----------------LNSENT----KLFSLRYAYYDDVGDLELVKGYN 137
            .|      |..:.|.                 |||.|:    |.|.....:.:|      :|.|.
  Rat    66 TEKSADCHDEESVHEQFQKLMTQLNKSNDAYDLNSANSIYGAKHFPFLQTFLED------IKEYY 124

  Fly   138 SVVLEGVGEGNVVLREGRPRGVDFDQGASII---INDDIDKASHAKIFSSYSRRSFNSTVTVLGI 199
            ...:|               .:||...|...   ||..::..::.||...:.:.|.||:..::.:
  Rat   125 QANVE---------------SLDFAHAAEESEKKINSWVENQTNGKIKDLFPKGSLNSSTILVLV 174

  Fly   200 TVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHE 264
            ...|||.:|.:.||:..|:.::|: ...:.:..|:||.|..::.:: .::.:||.::|:|:...|
  Rat   175 NAVYFKGQWNHKFDEKHTEEDKFW-LNKNTSKPVQMMRQKNEFNFI-FLEDVQAKMVEIPYKGKE 237

  Fly   265 LVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEASK----------NESDVEVKLPKFDTRSVL 319
            |.|.::||            ::..||.:|.|:|.|.|          |..|:.:.||:|......
  Rat   238 LSMFILLP------------MEIDGLKKLEEQLTADKLLEWTRAENMNMIDLYLSLPRFKVEEKY 290

  Fly   320 SLEDTVYEAGLTD-LRNEFADLGRMLIPTGDRGAYLS--LYHQFARIVVDEEGLPNAVP-----Q 376
            .|...:...|:.| ..::.||...|   :..:|..:|  |:..|  :.|:|||...|..     .
  Rat   291 DLPGPLQHMGMVDAFDSKKADFSGM---SSTQGLMVSKVLHKSF--VEVNEEGTEAAAATGVEVS 350

  Fly   377 KSSGTNNIKFHINRPFAYLVLQRTHKLLIHSG 408
            .:|......|:.:.||.:|:.......::..|
  Rat   351 LTSAQITEDFNCDHPFLFLIKHNATNSILFFG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 96/422 (23%)
Serpinb3aXP_006249702.1 SERPIN 5..387 CDD:294093 96/422 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.