DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINC1

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens


Alignment Length:459 Identity:107/459 - (23%)
Similarity:171/459 - (37%) Gaps:113/459 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TKSLLQKMTDARLQFALNLLQMESTHL-----NLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRD 85
            |...:.:::.|..:||....|    ||     :.:|..::|.|..:...|...||...||:|:.:
Human    76 TNRRVWELSKANSRFATTFYQ----HLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLME 136

  Fly    86 VLAIYVDYPTLRRWYED----------VRAYHYLNSENTKLFSLRYAY----------YDDVGDL 130
            |.    .:.|:.....|          .|.|...| :::||.|....:          |.|:.  
Human   137 VF----KFDTISEKTSDQIHFFFAKLNCRLYRKAN-KSSKLVSANRLFGDKSLTFNETYQDIS-- 194

  Fly   131 ELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGAS---IIINDDIDKASHAKIFSSYSRRSFNS 192
            |||.|                  .:.:.:||.:.|.   ..||..:...:..:|.......:.|.
Human   195 ELVYG------------------AKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINE 241

  Fly   193 TVTVLGITVSYFK-----------------------------------------AKWKYPFDKSQ 216
            ...::.:...|||                                         ..||..|....
Human   242 LTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPEN 306

  Fly   217 TKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLV 281
            |:.|.||.|.|... ...||.|.||:.|....:|.|  ||||||...::.|::|||||.:.::.|
Human   307 TRKELFYKADGESC-SASMMYQEGKFRYRRVAEGTQ--VLELPFKGDDITMVLILPKPEKSLAKV 368

  Fly   282 LKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIP 346
            .|:|....|...|:|||    |..:.|.:|:|......||::.:.:.||.||.:........::.
Human   369 EKELTPEVLQEWLDELE----EMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVA 429

  Fly   347 TGDRGAYLS-LYHQFARIVVDEEGLPNA------VPQKSSGTNNIKFHINRPFAYLVLQRTHKLL 404
            .|....|:| .:|: |.:.|:|||...|      :..:|...|.:.|..||||...:.:.....:
Human   430 EGRDDLYVSDAFHK-AFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTI 493

  Fly   405 IHSG 408
            |..|
Human   494 IFMG 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 106/449 (24%)
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 107/459 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.