DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Acp76A

DIOPT Version :10

Sequence 1:NP_649207.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:125 Identity:40/125 - (32%)
Similarity:42/125 - (33%) Gaps:61/125 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PYPPPH-------RHPPPFHHPPPPRP---PPPEP---------------------RPP------ 29
            |.|||.       |.||...:|..|||   |..:|                     |||      
  Fly   545 PLPPPQNLALNLPRPPPSVQYPGAPRPLGVPMMQPMYQQHQLSMSGPHGHPSMMMSRPPQMQPVM 609

  Fly    30 --PPPPG--------PQP----PP-------PPPPRPDPPPPLPGATWFPGLLGPRPPRP 68
              |||||        |||    ||       |||....||||.||..  |..| |..|.|
  Fly   610 RVPPPPGSQFSHMQVPQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEA--PPPL-PEEPEP 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_649207.1 serpin 33..412 CDD:476815 21/55 (38%)
Acp76ANP_524153.1 serpin 28..369 CDD:476815
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.