DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:407 Identity:100/407 - (24%)
Similarity:189/407 - (46%) Gaps:72/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ARLQFALNLLQM--ESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRR 98
            |.::||:.:.:.  ||.    :|...:|.|..:.:.|...||:|.|..||..||. :::  |.::
Mouse     7 ADVKFAVEMYRQLRESD----KNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQ-FIE--TTKK 64

  Fly    99 WYEDVRAYHYLNSENT-----KLFSLRYAYYDDVGDLELVKGYNSV-----------VLEGVGEG 147
            ..|  ::.|..:.||.     ||.:......||. ||   |..||:           .||.:.| 
Mouse    65 TTE--KSEHCDDEENVHEQFQKLITQLNKSNDDY-DL---KAANSIYGAKGFPFLQTFLEDIKE- 122

  Fly   148 NVVLREGRPRGVDFD---QGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWK 209
               ..:.:...:||:   :.:...||..::..::.||...:...|.:|:..::.:...|||.:|.
Mouse   123 ---YYQAKVESLDFEHATEESEKKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWN 184

  Fly   210 YPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGK--YAYVNNVKGLQADVLELPFGEHELVMIVILP 272
            ..|:::.|:.|:|: ...:.:..|:||.|..|  ::::.:|   .|.::|:|:...:|.|.|:||
Mouse   185 RKFNENHTREEKFW-LNKNTSKPVQMMKQRNKFNFSFLGDV---HAQIVEIPYKGKDLSMFVLLP 245

  Fly   273 KPSQRVSLVLKQL-KNLGLHRLLEELEA-SKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRN 335
            .....    |||| :.|...:|||.::| :.:.:::.:.||:|.......|:..:...|:.|..:
Mouse   246 MEIDG----LKQLEEQLTTDKLLEWIKAENMHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFD 306

  Fly   336 -EFADL-GRMLIPTGDRGAYLS--LYHQFARIVVDEEGLPNAVPQKSSGTN-NIK-------FHI 388
             :.||. |...||    |..:|  |:..|  :.|:|||...|.   ::|.. :::       |..
Mouse   307 PQKADFSGMSSIP----GLVVSKVLHKSF--VEVNEEGTEAAA---ATGVEVSVRSAQIAEDFCC 362

  Fly   389 NRPFAYLVLQR-THKLL 404
            :.||.:.::.| |:.:|
Mouse   363 DHPFLFFIIHRMTNSIL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 100/407 (25%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 100/407 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.