DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:402 Identity:99/402 - (24%)
Similarity:166/402 - (41%) Gaps:74/402 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTL-KQIRDVLAIYVDY 93
            :::::.|...|||.|....|......|. .:|||..|.:.|.:.||:|::. ..:|.....:.|.
  Rat     1 MEQLSSANSLFALELFHTLSESSPTGNI-FSPFSISSALAMVFLGAKGSSAPSSLRLAETFHFDS 64

  Fly    94 PTLRRWYEDVRA-YHYLNSENTK---LFSLRYA--YYDDVGDLELVKGYNSVVLEGVGEGNVVLR 152
                  .||:.: :..||:|..|   ..:|:.|  .|.:       |.||.:.........:...
  Rat    65 ------VEDIHSRFQSLNAEMRKHGASHTLKVANRLYGE-------KTYNFLPEFLASTQKMYGA 116

  Fly   153 EGRPRGVDFDQGASIIINDDIDK----ASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPF- 212
            :..|  ||| |.||.....:|:|    .:..||....:....|||..::.:...|||..|:..| 
  Rat   117 DLAP--VDF-QHASEDARKEINKWVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGIWQEKFL 178

  Fly   213 -----------DKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELV 266
                       :|..||:             |:||.|..|:.: ..:..|:..|||:|:...||.
  Rat   179 TRHTTDAPFRLNKKDTKM-------------VKMMYQKEKFPF-GYIPDLKCKVLEMPYQGGELS 229

  Fly   267 MIVILPKPSQRVSLVLKQL-KNLGLHRLLE-ELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAG 329
            |:::||:..:..|..|::: :.|.|.:|.| ....:..|.||.|.||||.......|...:...|
  Rat   230 MVILLPEDIEDESTGLQKIEEQLTLEKLYEWTKHENLKEIDVHVNLPKFKIEESYILNSNLGRLG 294

  Fly   330 LTDL-RNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSSGTNNI--------- 384
            |.|| .:..|||..|   :..|..::|.....:.:.|:|||     .:.::.|..:         
  Rat   295 LQDLFSSSKADLSGM---SESRDIFISKIVHKSFVEVNEEG-----TEAAAATAGLVEYCLVSIE 351

  Fly   385 KFHINRPFAYLV 396
            .|.::.||.:.:
  Rat   352 AFIVDHPFLFFI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 99/396 (25%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 99/402 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.