DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinc1

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:417 Identity:104/417 - (24%)
Similarity:176/417 - (42%) Gaps:70/417 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TKSLLQKMTDARLQFALNLLQMESTHL-----NLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRD 85
            |...:.:::.|..:||.|..|    ||     :.:|..::|.|..:...|...||...||||:.:
  Rat    77 TNRRVWELSKANSRFATNFYQ----HLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLME 137

  Fly    86 VLAIYVDYPTLRRWYED----------VRAYHYLNSEN-----TKLF---SLRY-AYYDDVGDLE 131
            |.    .:.|:.....|          .|.|...|..:     .:||   ||.: ..|.||.  |
  Rat   138 VF----KFDTISEKTSDQIHFFFAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVS--E 196

  Fly   132 LVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQG---ASIIINDDIDKASHAKIFSSYSRRSFNST 193
            :|.|                  .:.:.:||.:.   :.:.||:.:...:..:|.....:.:.:..
  Rat   197 IVYG------------------AKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAIDEL 243

  Fly   194 VTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLEL 258
            ..::.:...|||..||..|....|:.|.|:...|... .|.||.|.||:.|....:|.|  |||:
  Rat   244 TALVLVNTIYFKGLWKSKFSPENTRKEPFHKVDGQSC-LVPMMYQEGKFKYRRVGEGTQ--VLEM 305

  Fly   259 PFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLED 323
            ||...::.|::|||||.:.::.|.::|....|...|:||    :|..:.|.:|:|......||::
  Rat   306 PFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDEL----SEVMLVVHVPRFRIEDSFSLKE 366

  Fly   324 TVYEAGLTDLRNEFADLGRMLIPTGDRGAYLS-LYHQFARIVVDEEGLPNA------VPQKSSGT 381
            .:.:.||.||.:........:|..|....::| .:|: |.:.|:|||...|      :..:|...
  Rat   367 QLQDMGLVDLFSPEKSQLPGIIAEGRDDLFVSDAFHK-AFLEVNEEGSEAAASTSVVITGRSLNP 430

  Fly   382 NNIKFHINRPFAYLVLQRTHKLLIHSG 408
            :.:.|..||||..|:.:.....:|..|
  Rat   431 SRVTFKANRPFLVLIREVALNTIIFMG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 103/407 (25%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 103/414 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.