DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb12

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_038946584.1 Gene:Serpinb12 / 304692 RGDID:1566382 Length:423 Species:Rattus norvegicus


Alignment Length:325 Identity:83/325 - (25%)
Similarity:137/325 - (42%) Gaps:56/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 HYLNSENTKL-----FSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGAS 166
            ||..|...:|     |.:...|.||:.:.     |::.:                ..|||.:...
  Rat   127 HYTLSMANRLYGEQEFPICPEYSDDITEF-----YHTTI----------------ESVDFQKDTE 170

  Fly   167 II---INDDIDKASHAKIFSSYSRRSF-NSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGG 227
            ..   ||..::..|..||...:.:.:. ||||.|| :...||||||:..|| |:..|:..:....
  Rat   171 KSREEINFWVESQSQGKIKELFDKEAIDNSTVLVL-VNAVYFKAKWEKEFD-SENTVDAPFCLSE 233

  Fly   228 SPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHR 292
            :....|:||.|.|::. :..::.|||.:||:.:...:|.|:|:||..|:.....|::|:....| 
  Rat   234 NEKKTVKMMNQKGQFR-IGFIEELQAQILEMKYTTGKLSMLVLLPSSSEDNVKSLQELEKKINH- 296

  Fly   293 LLEELEASKN-----ESDVEVKLPKFDTRSVLSLEDTVYEAGLTDL-RNEFADLGRMLIPTG--- 348
              |:|.|..|     |..|.:..|:|.......|...:.:.|:.|: ....|||      ||   
  Rat   297 --EKLLAWSNPENMSEKPVAISFPQFIMEDSYDLNSVLQDMGIRDVFDGTKADL------TGISK 353

  Fly   349 DRGAYLSLYHQFARIVVDEEG-----LPNAVPQKSSGTNNIKFHINRPFAYLVLQRTHKLLIHSG 408
            ....:||.......:.|||.|     ...||..:.:..:.::|:.||||.:.:.....:.|:..|
  Rat   354 SPSLHLSKVVHKTFVEVDEMGTQAAAASGAVVAEKALPSRVEFNANRPFLFFIRHNGTQSLLFCG 418

  Fly   409  408
              Rat   419  418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 83/325 (26%)
Serpinb12XP_038946584.1 serpinB12_yukopin 1..423 CDD:381037 83/325 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.