DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb13

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:432 Identity:92/432 - (21%)
Similarity:163/432 - (37%) Gaps:97/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYP 94
            :..::.|...|..:|.: |....:..|...:|....:.:.|...|.:|.|..:::.||  |.:..
  Rat     1 MDSLSTATTHFLFDLFK-ELNKTSDGNVFFSPLGISTAIGMILLGTQGATASELQKVL--YSEQG 62

  Fly    95 T-------LRRWYEDVRAYHY-----------------------LNSENTKLFSLRYAYYDDVGD 129
            |       ..:..|.....|:                       |..|.|.||..:|        
  Rat    63 TGSSRLKSEEKEIEKTEEIHHQFQKLLTEISKPTKDYDLIISNRLYGERTYLFLQKY-------- 119

  Fly   130 LELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTV 194
            ::.|:.|....||.|...|.. .|.|.:           ||..::..::.|:...:...|.||:.
  Rat   120 IDYVEKYYHASLEPVDFVNAA-DESRKK-----------INSWVESQTNEKVKDLFPEGSLNSST 172

  Fly   195 TVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELP 259
            .::.|...|||..|...|.|..||.|.|: ...:.:..|:||.|...::: ..::.|||.::.:|
  Rat   173 KLVLINTVYFKGLWDREFKKEHTKEEDFW-LNKNISKPVQMMAQCSSFSF-TLLEDLQAKIVGIP 235

  Fly   260 FGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEASK----------NESDVEVKLPKFD 314
            :...:..|.|:||....            ||.:::::|...|          .:..|:::||:..
  Rat   236 YKNSDFSMFVLLPNDID------------GLEKIIDKLSPEKLVEWTSPGQLKQRKVDLRLPRLK 288

  Fly   315 TRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSS 379
            ......|:.|:...|:....:|.||...|...:|.:.... |:..|  :||.|||:     :.::
  Rat   289 VEETYDLQPTLEAVGIHSAFSEHADYSGMSAHSGLQTQNF-LHRSF--LVVTEEGV-----EATA 345

  Fly   380 GTNNIKF-----------HINRPFAYLVLQRTHKLLIHSGVF 410
            || .:.|           |.|.||.:.|..|....::..|.|
  Rat   346 GT-GVGFKVLSAASCELVHCNHPFLFFVRHRESDSILFFGRF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 91/424 (21%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 92/429 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.