DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb3

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:442 Identity:97/442 - (21%)
Similarity:172/442 - (38%) Gaps:132/442 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ARLQFALNLL-QMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVL------------ 87
            |..||.|.|. |:..:.   :|...:|.|..:.:.|...||:|.|.|||...|            
  Rat     7 ATTQFTLELYRQLRDSE---DNIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKPKEK 68

  Fly    88 ----------------------------------AIY--VDYPTLRRWYEDVRAYHYLNSENTKL 116
                                              :||  ..:|.|:.:.||::.|:..|.|    
  Rat    69 SADSHDEENVHEQFRKIMNQLNKSNGAYDLKSPNSIYGAKGFPFLQTFMEDIKKYYQANVE---- 129

  Fly   117 FSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASIIINDDIDKASHAKI 181
             ||.:|:                          ...|.:.:           ||..::..::.||
  Rat   130 -SLDFAH--------------------------AAEESQKK-----------INSWVENKTNGKI 156

  Fly   182 FSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVN 246
            ...:.|.|.||:..::.:...|||.:|.:.||:.:|:.::|: ...:.:..|:||.||.::.:: 
  Rat   157 KDLFPRGSLNSSTILVLVNAVYFKGQWNHKFDEQRTREDKFW-LNKNTSKPVQMMRQTNEFNFI- 219

  Fly   247 NVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEAS--------KN- 302
            .::.:||.::|:|:...||.|.::||            ::..||.:|.|:|.|.        || 
  Rat   220 FLEDVQAKMVEIPYKGKELSMFILLP------------MEIDGLKKLEEKLSADTLLAWTSPKNM 272

  Fly   303 -ESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRN-EFADLGRMLIPTGDRGAYLS--LYHQFARI 363
             .:.:.:.||:|..:....|...:...|:.|..| :.||...|   :..:|..:|  |:..|  :
  Rat   273 RMTQLNLSLPRFKVQEKYDLPGPLEHMGMVDAFNPQKADFSGM---SSTKGLVVSKVLHKSF--L 332

  Fly   364 VVDEEGLPNAV-----PQKSSGTNNIKFHINRPF-AYLVLQRTHKLLIHSGV 409
            .|:|||...|.     .:..|.....:|..|||| .::....|:.:|....|
  Rat   333 EVNEEGAEAAAATGVETRILSAPRTTEFTCNRPFIVFIKPNNTNSILFFGRV 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 97/442 (22%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.