DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina9

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:439 Identity:99/439 - (22%)
Similarity:175/439 - (39%) Gaps:74/439 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGFLGLFGMVLSLRAH--ICANTVDTK-SLLQKMTDARLQFALNLLQMESTHLNLENFAMTPFST 64
            :||......:||..::  .|.:.:..| :...::|.:..:||..|.|..:.....:|...:|.|.
  Rat    12 VGFCAPMSCMLSFNSNHRECPHPLSMKRNPASQVTPSNTKFAFLLYQRLAQKSPGQNILFSPVSI 76

  Fly    65 WSLMIMFYEGAEGTTLKQIRDVLAIYVDY---PTLRRWYEDVRAYHYLNSENTKLFSLRYAYYDD 126
            .:.:.|...||...|..||...|...:.:   .|:...:|.:  .|.||..:.            
  Rat    77 STSLAMLSLGACSATKTQILRSLGFNITHIAEHTIHLGFEQL--VHSLNECHK------------ 127

  Fly   127 VGDLELVKGYNSVV------------LEGVGE--GNVVLREGRPRGVDFDQG--ASIIINDDIDK 175
              ||||..|  ||:            |:.|.:  |..|..|      ||...  |...||..:::
  Rat   128 --DLELRMG--SVLFIRKELQLQVKFLDRVKKLYGTKVFSE------DFSNAVTAQAQINSYVER 182

  Fly   176 ASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQT-KVEQFYNAGGSPAGKVEMMVQT 239
            .:..|:....  :..:|...::.:...:|||.|..||..:.| |...|..:.|:.. .|.||.||
  Rat   183 ETKGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTV-HVPMMHQT 244

  Fly   240 GKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEASKNES 304
            ..:|:..: :.|...:|::.: ..:.|...:||...:     ::||:.....|.|.....|..:.
  Rat   245 ESFAFGVD-RELGCSILQMDY-RGDAVAFFVLPGKGK-----MRQLERSLSPRRLRRWSRSLQKR 302

  Fly   305 DVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVD--E 367
            .::|.:|||...:..:||..:.|.|:.|..|..||...:     .:..:|.:.....:.|:|  |
  Rat   303 WIKVFIPKFSISASYNLETILPEMGIRDAFNSNADFSGI-----TKTHFLQVSKAAHKAVLDVSE 362

  Fly   368 EGLPNA--------VPQKSSGTNNIKFHINRPFAYLVLQRTHKLLIHSG 408
            ||...|        |..:.:.::.|.|  |.||..|:|.:..:.::..|
  Rat   363 EGTEAAAATTTKLIVRSRDTPSSTIAF--NEPFLILLLDKNTESILFLG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 92/403 (23%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 94/419 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.