DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb1a

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001026812.1 Gene:Serpinb1a / 291091 RGDID:1306203 Length:379 Species:Rattus norvegicus


Alignment Length:384 Identity:99/384 - (25%)
Similarity:159/384 - (41%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYP 94
            :::::.|...|||.|....|......|...:|||..|.:.|.:.|.:|||..|:..  ..:.|. 
  Rat     1 MEQLSSANSLFALELFHTLSESSPTGNIFFSPFSISSALAMVFLGTKGTTAAQLSK--TFHFDS- 62

  Fly    95 TLRRWYEDVRA-YHYLNSENTK-----LFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLRE 153
                 .|||.: :..||:|.:|     ...|....|.:       |.||.:.........:...:
  Rat    63 -----VEDVHSRFQSLNAEVSKRGASHTLKLANRLYGE-------KTYNFLPEFLTSTQKMYGAD 115

  Fly   154 GRPRGVDF---DQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKS 215
            ..|  |||   .:.|...||..:...:..||....:....:|...::.:...|||..|:..|.|.
  Rat   116 LAP--VDFQHASEDARKEINQWVKGQTEGKIPELLAVGVVDSMTKLVLVNAIYFKGMWEEKFMKQ 178

  Fly   216 QTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSL 280
            .| .:..:.........|:||.|..|: :...:..|:..|||:|:...||.|:::||:..:..|.
  Rat   179 DT-TDAPFRLNKKNTKSVKMMYQKKKF-FFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDEST 241

  Fly   281 VLKQL-KNLGLHRLLEELEASKNES-DVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEF-ADLGR 342
            .||:: :.:.|.:|.|..:....|: ||.||||:|.......|...:...||.||.|.. |||..
  Rat   242 GLKKIEEQITLEKLREWTKRENLENIDVHVKLPRFKIEESYILNSNLGRLGLQDLFNSSKADLSG 306

  Fly   343 MLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSSGT-----NNIKFHINRPFAYLV 396
            |   :|.|..::|.....|.:.|:|||...|.......|     ...:|..:.||.:.:
  Rat   307 M---SGSRDLFISKIVHKAFVEVNEEGTEAAAATAGIATFCMLLPEEEFTADHPFIFFI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 99/378 (26%)
Serpinb1aNP_001026812.1 SERPIN 4..379 CDD:294093 99/381 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.