DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:415 Identity:97/415 - (23%)
Similarity:174/415 - (41%) Gaps:74/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQKMTDARLQFALNLLQM---ESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIY- 90
            :..:.:|...|||.:|::   :|:    :|...:|.|.:|.:.|...||.|||..||..||::| 
  Rat     1 MDPLLEANATFALKVLRVLGEDSS----KNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYN 61

  Fly    91 ------VDYPTLRRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNV 149
                  .|:.         :.:..|.:|..|  |.|         ..::|..|||.:|...|   
  Rat    62 CNGNGGGDFH---------QCFQSLLTEVNK--SDR---------RHMLKTSNSVFVEDSFE--- 103

  Fly   150 VLR----------EGRPRGVDFDQGA----SIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGIT 200
            :|.          |.....:|| :||    ...||..:.|.:...|....|..:.||...::.:.
  Rat   104 ILASFKDSCRKFYEAEIENMDF-KGAPEQSRQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMN 167

  Fly   201 VSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHEL 265
            ..|||..|:.||:|..|: |..:....:....|:||.....:. ..:|:.:...:..||:..::|
  Rat   168 SFYFKGNWEKPFNKEDTR-EMPFKVSKNEKKIVQMMFNKSNFR-TYHVEDISTTLALLPYLGNQL 230

  Fly   266 VMIVILPKPSQRVSLVLKQLKNLGLHRLLE--ELEASKNESDVEVKLPKFDTRSVLSLEDTVYEA 328
            .:.::||.....:..|..|:.   ..:|:|  .|| :..|.:||:.||:|.......:::.:.:.
  Rat   231 SITIMLPDEYVELRTVENQIT---YEKLIEWTRLE-NMQEEEVEILLPRFKLEESYDMKNVLCKL 291

  Fly   329 GLT----DLRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQK----SSGTNNIK 385
            |:|    |.|.:|:.:      :...|.:||.....:.:.|:|||...|.|.:    .|..:...
  Rat   292 GMTNAFEDGRADFSGI------SSKPGLFLSKVVHKSVVEVNEEGTEAAAPTEIVTMGSPLSPQC 350

  Fly   386 FHINRPFAYLVLQRTHKLLIHSGVF 410
            ...:.||.:|:....:|.::..|.|
  Rat   351 LVADHPFLFLIQDDRNKAILFLGRF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 96/407 (24%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.