DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina1

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:427 Identity:105/427 - (24%)
Similarity:169/427 - (39%) Gaps:82/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSLRAHIC----------ANTVDTKSLLQKMTDARL-----QFALNLLQMESTHLNLENFAMTPF 62
            |.|.|.:|          |...||....|..|..::     .||.:|.:......|..|...:|.
  Rat     9 LLLLAGLCCLAPSFLAEDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPM 73

  Fly    63 STWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDV-RAYHYL-------NSE---NT-- 114
            |..:...|...|::|.|.|||.:.|    ::...:....|: :|:|:|       :||   ||  
  Rat    74 SITTAFAMLSLGSKGDTRKQILEGL----EFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGN 134

  Fly   115 KLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDF--DQGASIIINDDIDKAS 177
            .||..:        :|:||:.:    ||.| :.|.   ......|:|  .:.|..:|||.::|.:
  Rat   135 GLFVNK--------NLKLVEKF----LEEV-KNNY---HSEAFSVNFADSEEAKKVINDYVEKGT 183

  Fly   178 HAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKY 242
            ..||. ...::....||..| :...:||.|||.||:...|:...|: ...|...||.||.:.|.:
  Rat   184 QGKIV-DLMKQLDEDTVFAL-VNYIFFKGKWKRPFNPEHTRDADFH-VDKSTTVKVPMMNRLGMF 245

  Fly   243 --AYVNNVKG--LQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEASKNE 303
              .|.:.:..  |..|.|      .....|.:||...:...|.....|:| :.|.|    .::..
  Rat   246 DMHYCSTLSSWVLMMDYL------GNATAIFLLPDDGKMQHLEQTLTKDL-ISRFL----LNRQT 299

  Fly   304 SDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEE 368
            ....:..||.......:|:..:...|:|.:.|..|||..:   |.|....||.....|.:.:||.
  Rat   300 RSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGI---TEDAPLKLSQAVHKAVLTLDER 361

  Fly   369 G-------LPNAVPQKSSGTNNIKFHINRPFAYLVLQ 398
            |       :..|||.  |....:||  :.||.:::::
  Rat   362 GTEAAGATVVEAVPM--SLPPQVKF--DHPFIFMIVE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 96/394 (24%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 96/387 (25%)
RCL 367..386 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.