DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Agt

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_038953394.1 Gene:Agt / 24179 RGDID:2069 Length:489 Species:Rattus norvegicus


Alignment Length:424 Identity:84/424 - (19%)
Similarity:162/424 - (38%) Gaps:82/424 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VDTKSLLQKMTDARLQFALNLLQMESTHLNLENF-------------------AMTPFSTWSLMI 69
            ||.|:|..|:..|..:......|..:....:.||                   .::|.:.:..::
  Rat    82 VDEKTLRDKLVLATEKLEAEDRQRAAQVAMIANFMGFRMYKMLSEARGVASGAVLSPPALFGTLV 146

  Fly    70 MFYEGAEGTTLKQIRDVLAIYV---DYPTLRRWYEDVRAYHYL---------NSENTKLFSLRYA 122
            .||.|:...|..|::.:|.:.|   |..:....::.:.|...:         :|..|.|......
  Rat   147 SFYLGSLDPTASQLQVLLGVPVKEGDCTSRLDGHKVLTALQAVQGLLVTQGGSSSQTPLLQSTVV 211

  Fly   123 YYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQG---ASIIINDDIDKASHAKI--- 181
            .......|.|.:.:    :|.:|.....:   .||.:|....   |:..||..:...:..|:   
  Rat   212 GLFTAPGLRLKQPF----VESLGPFTPAI---FPRSLDLSTDPVLAAQKINRFVQAVTGWKMNLP 269

  Fly   182 ---FSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQ-TKVEQFYNAGGSPAGKVEMMVQTGKY 242
               .|:.|...||:.|        :|:.|.:   ..|| |.:.:|: ...|.:..|.|:..||.:
  Rat   270 LEGVSTDSTLFFNTYV--------HFQGKMR---GFSQLTGLHEFW-VDNSTSVSVPMLSGTGNF 322

  Fly   243 AYVNNVKGLQADVLELPFGEHELVMIVILPKPS---QRVSLVLKQLKNLGLHRLLEELEASKNES 304
            .:.::.:. ...|..:|.|| .:.:::|.|:.:   .||.:::.|      |..|..:   ||..
  Rat   323 QHWSDAQN-NFSVTRVPLGE-SVTLLLIQPQCASDLDRVEVLVFQ------HDFLTWI---KNPP 376

  Fly   305 D--VEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLS--LYHQFARIVV 365
            .  :.:.||:.:.|...:|:|.:.:|.|:.|....|:||:|    ||....:.  |......:..
  Rat   377 PRAIRLTLPQLEIRGSYNLQDLLAQAKLSTLLGAEANLGKM----GDTNPRVGEVLNSILLELQA 437

  Fly   366 DEEGLPNAVPQKSSGTNNIKFHINRPFAYLVLQR 399
            .||..|....|:......:...::.||.:.:.:|
  Rat   438 GEEEQPTESAQQPGSPEVLDVTLSSPFLFAIYER 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 79/412 (19%)
AgtXP_038953394.1 serpinA8_AGT 40..487 CDD:381010 84/424 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.