DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina3j

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:455 Identity:93/455 - (20%)
Similarity:166/455 - (36%) Gaps:114/455 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGFLGLFGMVLSLRAHIC-------ANTVDTKSLLQKMTDARLQ------------FALNL---L 45
            :.|:...|:   |.|.||       .:|:...:.:||..|...|            ||.:|   |
Mouse     1 MAFIAALGL---LMAGICPAVLCCPEDTLGKHTPVQKDRDHETQLDSLTLASINTDFAFSLYKKL 62

  Fly    46 QMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDVRAYHYLN 110
            .:::.|   :||..:|.|....:.....||:|.||::|.:.|.                    .|
Mouse    63 ALKNPH---KNFVFSPLSITIALASLSLGAKGNTLEEILEGLK--------------------FN 104

  Fly   111 SENTKLFSLRYAY------YDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRG----------V 159
            ...|....:...:      ....||...:...||:|:|   :...:|.|.:.:.          .
Mouse   105 LTETPEADIHQGFGHLLQRLSQPGDQVQISTGNSMVVE---KHLQILAEFKEKARALYHTEVFTA 166

  Fly   160 DFDQ--GASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQF 222
            ||.|  .|..::||.:...:...|....|  ......:::....:.|..||...||..:|.:..|
Mouse   167 DFQQPREARKLLNDYVSNQTQGMIKELVS--DLEERTSMVMTNFALFNGKWNMTFDPYETFMGTF 229

  Fly   223 YNAGGSPAGKVEMM-VQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLK 286
            .....:|. ||.|| ::..:..|..:.| ::..|:||.:..:...|. |||...:          
Mouse   230 IEDRRTPV-KVSMMKMKELRAPYFRDEK-MKCTVVELNYKGNGKAMF-ILPDQGK---------- 281

  Fly   287 NLGLHRLLEELEASKNESDV-------------EVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFA 338
                   ::::|||...:.:             |:.||||.......||:.:.|.|:.::.:..|
Mouse   282 -------MKQVEASLQPATLRGWRKSLRPRMIDELYLPKFSISKNYRLENILPELGIKEVFSTQA 339

  Fly   339 DLGRMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQK------SSGTNNIKFHINRPFAYLVL 397
            ||..:   :|.:...:|.....|.:.:.|.|.......:      |:.:|....::|.||.:.||
Mouse   340 DLSGI---SGGKDVRVSRMFHSAALDMTETGTEARATTRDKYDFLSTKSNPTVVNLNTPFLFCVL 401

  Fly   398  397
            Mouse   402  401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 83/415 (20%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 84/416 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.