DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina3k

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_035588.2 Gene:Serpina3k / 20714 MGIID:98377 Length:418 Species:Mus musculus


Alignment Length:439 Identity:101/439 - (23%)
Similarity:164/439 - (37%) Gaps:84/439 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGFLGLFGMVLSLRAHICANTV-----------------------DTKSLLQKMTDARLQFALNL 44
            :.|:...||:  |.|.||...:                       |:.:|....||    ||.:|
Mouse     1 MAFIVAMGMI--LMAGICPAVLCFPDGTKEMDIVFHEHQDNGTQDDSLTLASVNTD----FAFSL 59

  Fly    45 LQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLA----------IYVDYPTLRRW 99
            .:..:.....:|...:|.|..:.:.:...||:|.|:::|.:.|.          |:..:..|.:.
Mouse    60 YKKLALKNQDKNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETPEADIHQGFGNLLQS 124

  Fly   100 YEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQ- 163
            .........:|..|.....         .||:::..::        |....|.:......||.| 
Mouse   125 LSQPEDQDQINIGNAMFIE---------KDLQILAEFH--------EKTRALYQTEAFTADFQQP 172

  Fly   164 -GASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGG 227
             .|..:|||.:...:...|....|... :.|:.|| :...|||.|||..||...|...:|| ...
Mouse   173 TEAKNLINDYVSNQTQGMIKKLISELD-DGTLMVL-VNYIYFKGKWKISFDPQDTFESEFY-LDE 234

  Fly   228 SPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQ-RVSLVLKQLKNLGLH 291
            ..:.||.||......|.....:.|...||||.:..:...::::   |.| |:..|...|:...|.
Mouse   235 KRSVKVPMMKMKLLTARHFRDEELSCSVLELKYTGNASALLIL---PDQGRMQQVEASLQPETLR 296

  Fly   292 RLLEELEASKNESDVEVKLPKFDTRSVLSL-EDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLS 355
            :..:.|.:|:.|   |:.||||...|...| ||.:.|.|:.::..|.|||..:     .....||
Mouse   297 KWRKTLFSSQIE---ELNLPKFSIASDYRLEEDVLPEMGIKEVFTEQADLSGI-----TEAKKLS 353

  Fly   356 LYHQFARIVVD--EEGLPNAVPQKSSGTNNIKFHI------NRPFAYLV 396
            :.....:.|:|  |.|...|......|  .|:..:      ||||..::
Mouse   354 VSQVVHKAVLDVAETGTEAAAATGVIG--GIRKAVLPAVCFNRPFLIVI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 90/383 (23%)
Serpina3kNP_035588.2 SERPIN 57..417 CDD:214513 88/377 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.