DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and Serpina12

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:480 Identity:105/480 - (21%)
Similarity:182/480 - (37%) Gaps:157/480 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGLFGMVLSLRAHICANTVDTKSLLQ------------------------KMTDARLQFALNLLQ 46
            ||||          .|..:..|.|||                        ::|...::|...|||
  Rat     7 LGLF----------LAGLLTVKGLLQDRDAPDTYESPVRVQEWRGKKDARELTRHNMEFGFKLLQ 61

  Fly    47 MESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDV------RA 105
            ..:::....|..::|.|..:...|...||:.:||::||:...           ::::      ..
  Rat    62 RLASNSRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFN-----------FKEMSDRDMHMG 115

  Fly   106 YHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVD---------F 161
            :|||..:..:          :..|:::     |:       ||.:..:.|.|...         :
  Rat   116 FHYLLQKLNR----------ETQDVKM-----SI-------GNALFMDQRLRPQQRFLKLAKNLY 158

  Fly   162 DQGASIIINDDIDKASHAKIFSSY-SRRSFN-----------STVTVLGITVSYFKAKWKYPFDK 214
            |  |.:|:.:..|..:..|..:.| ||::.|           .||.:| ....||:.:|:|.||.
  Rat   159 D--ADMILTNFQDLENTQKNINKYISRKTHNRIENMVKNIDPGTVMLL-TNYIYFQGRWQYEFDP 220

  Fly   215 SQTKVEQFYNAGGSPAGKVEMMVQTGKY--AYVNNVKGLQADVLELPFGEHELVMIVILPKPSQR 277
            .|||.|.|:...|... ||.||.|.|.|  ||.:.   |...:||:|: ...:....:||     
  Rat   221 KQTKEEDFFIEEGKTV-KVPMMFQRGMYDMAYDSQ---LSCTILEMPY-RRNITATFVLP----- 275

  Fly   278 VSLVLKQLKNLGLHRLLEE-LEA----------SKNESDVEVKLPKFDTRSVLSLEDTVYEAGLT 331
                     :.|..||||: |:|          ||...||.|  |:....:..:::..:...|::
  Rat   276 ---------DSGKLRLLEQGLQADIFAKWKSLLSKRVVDVWV--PRLHISATYNMKKVLSRLGIS 329

  Fly   332 DLRNEFADLGRMLIPTGDRGAYLSL-----YHQFARIVVDEEGLPNAVPQKSSGTNNI------K 385
            .:..|..||.|:       .::.||     .|: |.:.::|:|...|.   .||...:      :
  Rat   330 KIFEEHGDLTRI-------SSHRSLKVGEAVHK-AELRMNEKGTEGAA---GSGAQTLPMETPRR 383

  Fly   386 FHINRPFAYLVLQRTHKLLIHSGVF 410
            ..:|.||..::.:.    |:.|.:|
  Rat   384 MKLNAPFLMMIYEN----LMPSMIF 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 94/424 (22%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 95/426 (22%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.