DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and SERPINA3

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:430 Identity:94/430 - (21%)
Similarity:165/430 - (38%) Gaps:73/430 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGLFGMVLSLRAHICA-------NTVDTKSLLQKMTD-----------ARLQFALNLLQMESTHL 52
            |||      |.|..|.       :.:|.::|.|:..|           |.:.||.:|.:......
Human    10 LGL------LAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKA 68

  Fly    53 NLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDVRAYHYLNSENTKLF 117
            ..:|...:|.|..:.:.....||..|||.:|...|...:...:....::..:  |.|.:.|....
Human    69 PDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQ--HLLRTLNQSSD 131

  Fly   118 SLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASI--IINDDIDKASHAK 180
            .|:.:    :|:...||...| :|:...|....|........||...|:.  :|||.:...:..|
Human   132 ELQLS----MGNAMFVKEQLS-LLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGK 191

  Fly   181 IFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYV 245
            |....  :..:|...::.:...:|||||:.|||...|...:||     .:.|..:||......::
Human   192 ITDLI--KDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFY-----LSKKKWVMVPMMSLHHL 249

  Fly   246 N----NVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEASKNESDV 306
            .    ..:.|...|:||.:..:...:. |||...:     :::::.:.|...|:....|....::
Human   250 TIPYFRDEELSCTVVELKYTGNASALF-ILPDQDK-----MEEVEAMLLPETLKRWRDSLEFREI 308

  Fly   307 -EVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLSLYHQFARIVVDEEGL 370
             |:.||||......:|.|.:.:.|:.:.....|||..:   ||.|...:|.....|.:.|.||| 
Human   309 GELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGI---TGARNLAVSQVVHKAVLDVFEEG- 369

  Fly   371 PNAVPQKSSGTNNIKF-------------HINRPFAYLVL 397
                 .::|....:|.             ..||||..:::
Human   370 -----TEASAATAVKITLLSALVETRTIVRFNRPFLMIIV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 84/382 (22%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 85/394 (22%)
RCL 369..394 3/30 (10%)
O-glycosylated at one site 381..389 0/7 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.