DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and LOC100909605

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:403 Identity:100/403 - (24%)
Similarity:170/403 - (42%) Gaps:47/403 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VDTKSLLQKMTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLA 88
            ||:.:|....||    ||.:|.:........:|...:.||..:.:::...||:..|||:|.:.|.
  Rat    32 VDSSTLSSCNTD----FAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLK 92

  Fly    89 I-YVDYP--TLRRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVV 150
            . ..:.|  .:.:.||.:.....|..:..::         ..|....:|.:..::.| ..|....
  Rat    93 FNLTETPEAEIHQGYEHLLQRLNLPGDQVQI---------STGSALFIKKHLQILAE-FQEKARA 147

  Fly   151 LREGRPRGVDFDQ--GASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFD 213
            |.:......||.|  .|..:|||.:.|.:..||....|  ..:...:::.:...|||.|||.|||
  Rat   148 LYQAEAFSTDFQQPHEAKKLINDYVRKQTQGKIKELIS--VLDKKTSMVLVNYIYFKGKWKMPFD 210

  Fly   214 KSQTKVEQFYNAGGSPAGKVEMM-VQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQ- 276
            ...|...:|| .....:.||.|| ::.....|..: :.|...||||.:..:...:.::   |.| 
  Rat   211 PHDTFQSEFY-LDEKKSVKVPMMKIEKLTTPYFRD-EELSCSVLELKYTGNASALFIL---PDQG 270

  Fly   277 RVSLVLKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLG 341
            |:..|...|:...|.|..:.|...:.:   |:::|||...:.:.|.|.:.|.|:.::.::.|||.
  Rat   271 RMQQVEASLQPETLRRWKDTLRPRRID---ELRMPKFSISTDMRLGDILPELGIREVFSQQADLS 332

  Fly   342 RMLIPTGDRGAYLSLYHQFARIVVDEEGLPNAVPQKSSGTNNI----KF-----HINRPFAYLVL 397
            |:   ||.:...:|.....|.:.|.|.|...|.   ::|...|    ||     :.||||..::.
  Rat   333 RI---TGAKDLSVSQVVHKAVLDVTETGTEAAA---ATGVKIIPMCAKFYYVTMYFNRPFLMIIS 391

  Fly   398 Q-RTHKLLIHSGV 409
            . .||..|..:.|
  Rat   392 DTNTHIALFMAKV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 95/391 (24%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 96/392 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.