DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Bc and serpinb11

DIOPT Version :9

Sequence 1:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002936466.1 Gene:serpinb11 / 100490487 XenbaseID:XB-GENE-6039640 Length:401 Species:Xenopus tropicalis


Alignment Length:356 Identity:79/356 - (22%)
Similarity:151/356 - (42%) Gaps:38/356 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRR--WY- 100
            :|:|::.:..::....:|...:|.|..:.:.:.:.|:...|..||:.|    |.||.:::  :: 
 Frog    10 EFSLDIFKELNSSCENKNIFFSPMSISAALYLLHLGSREDTATQIQKV----VRYPDVKKEGFFR 70

  Fly   101 ---------------EDVRAYHYLNSENTKLFSLRYAYYDDVG--DLELVKG----YNSVVLEGV 144
                           :||.....::..::|..:|.....:|..  :|::..|    .|...|:..
 Frog    71 RRCATQQRSNEESPGKDVSECGKVSDAHSKFHALLSKLTEDPKGVELQIANGMFAQMNFPFLQQY 135

  Fly   145 GEGNVVLREGRPRGVDFDQGAS-IIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKW 208
            .|....|...:.:.|||::..: ..||..::..:..||...:.:.|.:....::.:...|||..|
 Frog   136 LECAQALYNAKLQNVDFEKDETRENINSWVESKTQGKIKDLFEKNSLDKRTALVLVNAIYFKGIW 200

  Fly   209 KYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVILPK 273
            ..||.:..||...|| ........|.||.|:.|: .:..:|.|.|.:||||:....|.|.::|..
 Frog   201 SNPFQEVHTKDAPFY-VSKDVVKSVPMMYQSQKF-NLGAIKELNAQILELPYQLGALSMFILLTN 263

  Fly   274 PSQRVSLVLKQLKNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFA 338
            ....:..:.:||....|.:.:..:|.:|    ::|.:|:|.....|.|...:...|:.|   .|:
 Frog   264 EKFGLQKIEQQLSWNYLAKGMSNMENTK----LDVYIPRFRLEESLDLGSHLINMGMVD---AFS 321

  Fly   339 DLGRMLIPTGDRGAYLSLYHQFARIVVDEEG 369
            :....|....|...|:|.....|.:.|:|||
 Frog   322 EAKANLSGISDVPLYVSKIVHKAFVEVNEEG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 79/356 (22%)
serpinb11XP_002936466.1 serpinB 7..398 CDD:381072 79/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.