DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB7

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:402 Identity:104/402 - (25%)
Similarity:190/402 - (47%) Gaps:45/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV- 132
            :.|::....:|..:|.:  .::..:.|.:...|..|:::.|.|:..|::.::.:|:.|.|.:|. 
Human     1 MASLAAANAEFCFNLFR--EMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTA 63

  Fly   133 --------EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPME 188
                    ....|:...|...|.:|.:....:::.:..::..|.|....:|.:..:. |:.:...
Human    64 SGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVER 128

  Fly   189 VDF--YSPDSVIQINEDTNRTTRGLIPYTILPQDVYG-------AKMFLLSSLYFKGQWKFPFNK 244
            |||  :..|:...||:.....|.|.|      ::|.|       |.|.|::::||||:|:..|.|
Human   129 VDFTNHLEDTRRNINKWVENETHGKI------KNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTK 187

  Fly   245 TLTREEPFFSESGEVIGK-IPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFK 308
            :.|....|  :|.:..|| :.||.||..| .:|.:|.....:|||.|  ...:.|.|:||:.  .
Human   188 SETINCHF--KSPKCSGKAVAMMHQERKF-NLSVIEDPSMKILELRY--NGGINMYVLLPEN--D 245

  Fly   309 LNDVANNLKALGLRPILQRLAAFRN-RASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDEN 372
            |:::.|.|       ..|.|..:.| |......|||..|:|....::.:|..|..:|::|:|||:
Human   246 LSEIENKL-------TFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDES 303

  Fly   373 TANLDRMSSG--LFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKAT 435
            .|:|..::||  |:...::|.:.|.|.|:||.|.|.|.:.:..|..|...|......::.|.:..
Human   304 KADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQLPQSTLFRADHPFLFVIRKD 368

  Fly   436 GLLLFAGQVRNP 447
            .::||:|:|..|
Human   369 DIILFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 101/391 (26%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 103/400 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.